BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0350.Seq (702 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36| Best HMM Match : E-MAP-115 (HMM E-Value=0.39) 37 0.018 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 36 0.042 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.073 SB_46590| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_29776| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.17 SB_2435| Best HMM Match : WD40 (HMM E-Value=4.1e-10) 33 0.22 SB_17310| Best HMM Match : Filament (HMM E-Value=0.31) 33 0.22 SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) 33 0.22 SB_29054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.30 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 32 0.39 SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 32 0.52 SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.52 SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) 31 1.2 SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) 31 1.2 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 31 1.2 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 30 1.6 SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) 30 1.6 SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) 30 1.6 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_52732| Best HMM Match : M (HMM E-Value=0.019) 30 2.1 SB_7558| Best HMM Match : TPR_MLP1_2 (HMM E-Value=2.2) 30 2.1 SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) 30 2.1 SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_6600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_29786| Best HMM Match : I-set (HMM E-Value=0) 29 3.6 SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 29 3.6 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 29 3.6 SB_45073| Best HMM Match : ERM (HMM E-Value=0) 29 3.6 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 29 3.6 SB_26950| Best HMM Match : TBC (HMM E-Value=5.2e-28) 29 3.6 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 29 3.6 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_39219| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_30449| Best HMM Match : DUF566 (HMM E-Value=1.2) 29 4.8 SB_10312| Best HMM Match : MpPF2 (HMM E-Value=0.26) 29 4.8 SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 29 4.8 SB_58036| Best HMM Match : Cadherin (HMM E-Value=0) 29 4.8 SB_471| Best HMM Match : Laminin_EGF (HMM E-Value=0) 29 4.8 SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) 28 6.4 SB_7395| Best HMM Match : SURF6 (HMM E-Value=1.8) 28 6.4 SB_56317| Best HMM Match : DUF1273 (HMM E-Value=1.2) 28 6.4 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 28 6.4 SB_22642| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) 28 6.4 SB_53535| Best HMM Match : zf-C2H2 (HMM E-Value=4.8e-32) 28 8.4 SB_47240| Best HMM Match : Pkinase_C (HMM E-Value=2.8e-06) 28 8.4 SB_32407| Best HMM Match : WSC (HMM E-Value=0.0008) 28 8.4 SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_25942| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_12619| Best HMM Match : DUF837 (HMM E-Value=4.9) 28 8.4 SB_2704| Best HMM Match : TP2 (HMM E-Value=6.9) 28 8.4 SB_52671| Best HMM Match : SPAN-X (HMM E-Value=2.6) 28 8.4 SB_44957| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 28 8.4 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 28 8.4 SB_2860| Best HMM Match : IncA (HMM E-Value=0.41) 28 8.4 SB_227| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) 28 8.4 >SB_36| Best HMM Match : E-MAP-115 (HMM E-Value=0.39) Length = 383 Score = 36.7 bits (81), Expect = 0.018 Identities = 26/81 (32%), Positives = 43/81 (53%), Gaps = 3/81 (3%) Frame = +2 Query: 464 DHIRHGGRVKPATAKV---TTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELA 634 D I+ GG K T+ TE+ R ++ +++R +E RQR + Q Q++I+ + E A Sbjct: 26 DTIQIGGGSKNQTSYTYVDNTEKVRQEEEARERRRLENERRQREL-QEQERIEREKREAA 84 Query: 635 QAKSARHNHTFADAERLAEER 697 + R A+AER +ER Sbjct: 85 ALERQRFQQQLAEAERQEQER 105 Score = 35.1 bits (77), Expect = 0.056 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 3/96 (3%) Frame = +2 Query: 419 RSERTPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRT---V 589 R R RRQ + R K A + E QR+ QQLA+ +R+ E R++ + Sbjct: 56 RERRRLENERRQRELQEQERIEREKREAAAL--ERQRFQQQLAEAERQEQERRRKEEERI 113 Query: 590 SQMQKKIDSLQEELAQAKSARHNHTFADAERLAEER 697 ++ ++++ L+EE + A ++ F D LA R Sbjct: 114 AREKEQLRKLEEEAVTKRLALFDYKFGDKINLASFR 149 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 35.5 bits (78), Expect = 0.042 Identities = 42/192 (21%), Positives = 75/192 (39%) Frame = +2 Query: 119 REQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAAVLRSACSAPRPMTPXQTSPG*E 298 +E++ +LE + E R + + E K +E + AE A R R Sbjct: 288 KEEKRKLEAEKKEKERVEREQREERRKQEEKRRAEEQA--RRKAEEERAAKAKAEMEERM 345 Query: 299 PRRQPRTIADSTEGLAAQGDREAGDSGHGAAL*RPTQGTGRSERTPPKSRRQIQDDHIRH 478 + + + A+ E L DR+ A Q R R K R + +++ + Sbjct: 346 RKLEEKREAERQEALRIDRDRKQDAQKKVAEHVARLQEAER-RRAEAKERERQEEERRKG 404 Query: 479 GGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHN 658 R + K EE+ + A++QRE DE RQR + Q+ D Q + + + Sbjct: 405 EERQRQEEEKRQKEEEERLRVEAERQREEDE-RQRAEDERQRAEDERQRVKHEMQRLKDE 463 Query: 659 HTFADAERLAEE 694 A+ + +A + Sbjct: 464 RRRAEEDEIARQ 475 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 34.7 bits (76), Expect = 0.073 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 2/67 (2%) Frame = +2 Query: 488 VKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARH--NH 661 +K + + E +++A++ ADK +LDE RQ S +++++ SL EL KS++ Sbjct: 2143 IKASLQTLEQENKQFAKKAADKAMKLDETRQ-MCSDLKQEVVSLTNELQVIKSSKRELED 2201 Query: 662 TFADAER 682 F D E+ Sbjct: 2202 RFNDLEK 2208 >SB_46590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 972 Score = 33.9 bits (74), Expect = 0.13 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +2 Query: 407 QGTGRSERTPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADK 553 Q T + TPPKSR+ Q H G P +T EE + Q D+ Sbjct: 287 QNTPSDDSTPPKSRQSSQSSHSSKGDSDMPHPQILTREEAEFLQAFTDE 335 >SB_29776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/65 (30%), Positives = 35/65 (53%) Frame = +2 Query: 506 KVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHTFADAERL 685 + +TEEQ A+++ DK+R L E Q +++++ +L EE A AK R E+ Sbjct: 41 RTSTEEQANAKRIRDKERPLTE-EQANAKRIRERERTLTEEQANAKRIRERERPLTEEQA 99 Query: 686 AEERL 700 +R+ Sbjct: 100 NAKRI 104 Score = 30.3 bits (65), Expect = 1.6 Identities = 25/76 (32%), Positives = 37/76 (48%) Frame = +2 Query: 425 ERTPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQK 604 ER P + Q IR R +P T EEQ A+++ DK+R L E Q ++++ Sbjct: 174 ERERPLTEEQANAKRIRE--RERPLT-----EEQANAKRIRDKERTLTE-EQANAKRIRE 225 Query: 605 KIDSLQEELAQAKSAR 652 + + EE A AK R Sbjct: 226 RGHTSTEEQANAKRIR 241 >SB_33134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2208 Score = 33.5 bits (73), Expect = 0.17 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 5/72 (6%) Frame = +2 Query: 497 ATAKVTTEEQRWAQQLADKQR--ELDELRQRTV---SQMQKKIDSLQEELAQAKSARHNH 661 A +K++ + +R A K + E D + Q+ + SQM KK+ S ++ELA K+ H Sbjct: 1066 ANSKLSEDNERLTNNAAAKAQNIERDAIIQQLMDEKSQMSKKLQSKEDELATEKANSQKH 1125 Query: 662 TFADAERLAEER 697 T + + A+E+ Sbjct: 1126 TETLSSQRAKEK 1137 >SB_2435| Best HMM Match : WD40 (HMM E-Value=4.1e-10) Length = 1272 Score = 33.1 bits (72), Expect = 0.22 Identities = 22/80 (27%), Positives = 42/80 (52%), Gaps = 1/80 (1%) Frame = +2 Query: 419 RSERTPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQ-LADKQRELDELRQRTVSQ 595 RS+ + + +++++D R R A+ +V + QR + LA Q + E+ Sbjct: 797 RSQISHQRQQQELEDQLFR---RATNASQEVDLDSQRILHEDLAKAQSKKAEVDIEEEEG 853 Query: 596 MQKKIDSLQEELAQAKSARH 655 M+ +++SLQ E+ Q K +RH Sbjct: 854 MRSRLESLQREMDQVKVSRH 873 >SB_17310| Best HMM Match : Filament (HMM E-Value=0.31) Length = 458 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/71 (26%), Positives = 33/71 (46%) Frame = +2 Query: 485 RVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHT 664 RVK + TE + +QLA+++ ++ LR+ + + Q+ LQEE + R Sbjct: 236 RVKTLQNSLETERRMTMEQLAEERADVQRLREEFMREQQRVTLHLQEEKRALSTERAQLA 295 Query: 665 FADAERLAEER 697 E + ER Sbjct: 296 STHRELMTRER 306 >SB_11152| Best HMM Match : Myosin_head (HMM E-Value=0) Length = 1997 Score = 33.1 bits (72), Expect = 0.22 Identities = 17/60 (28%), Positives = 34/60 (56%) Frame = +2 Query: 482 GRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNH 661 G+V ++T +Q + ++LAD+ E+D LR+ Q+++D+LQ L +++ H Sbjct: 1592 GKVLKIQLEMTQLKQEFERKLADRDEEIDTLRK----NHQRQLDALQASLDSEVKSKNEH 1647 >SB_29054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 32.7 bits (71), Expect = 0.30 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 3/89 (3%) Frame = +2 Query: 440 KSRRQIQDDHIR---HGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKI 610 + +++ +D+ IR + +V T K T L+ Q + +RQ+ QMQ+K+ Sbjct: 239 RKKQEEEDEEIRQFVYAKKVVIYTKKNTNAYLPKQFLLSAFQDHTNRMRQKLADQMQQKV 298 Query: 611 DSLQEELAQAKSARHNHTFADAERLAEER 697 D E +A+A + R +A+R AEER Sbjct: 299 DDEDERIAKALAER------EAKREAEER 321 >SB_6450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 692 Score = 32.7 bits (71), Expect = 0.30 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +2 Query: 518 EEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHTFADAERLAEER 697 +E Q LA+++++ E +R Q K+D +E + A + H +AERLAEE+ Sbjct: 311 DEATAKQALAERRKKAREEAER-----QAKLDKEEERMQNAMEEKERHDREEAERLAEEQ 365 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/69 (26%), Positives = 31/69 (44%), Gaps = 3/69 (4%) Frame = +2 Query: 503 AKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSAR---HNHTFAD 673 AK+ EE+R + +K+R E +R + + K + +E Q + AR D Sbjct: 334 AKLDKEEERMQNAMEEKERHDREEAERLAEEQRMKEEERKEREEQERIAREEAEKKAIED 393 Query: 674 AERLAEERL 700 ER +E + Sbjct: 394 EERRKQEEI 402 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 32.3 bits (70), Expect = 0.39 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +2 Query: 83 AAHELESAQGSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAA 232 AA E + + +R ERL+ ELH H K+D+ + +A Q+ E+++ Sbjct: 16 AARAKEETERQAELERQMNERLQ-ELHAHMEKSDKNMREAHRKQIQEISS 64 >SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 31.9 bits (69), Expect = 0.52 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 2/89 (2%) Frame = +2 Query: 419 RSERTPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWA--QQLADKQRELDELRQRTVS 592 R E++ + Q ++ G + A+ K E+Q+ Q L+ ++ E+ E R R + Sbjct: 101 RKEKSTREEEFDNQMWELKQGHSKEVASLKQNFEQQKTELEQMLSREKSEMREARTREQN 160 Query: 593 QMQKKIDSLQEELAQAKSARHNHTFADAE 679 +MQ+K EL + H H A E Sbjct: 161 EMQQKFKRELSELRETLEKDHVHNLAVQE 189 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 31.9 bits (69), Expect = 0.52 Identities = 41/190 (21%), Positives = 79/190 (41%), Gaps = 18/190 (9%) Frame = +2 Query: 116 SREQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAAVLRSAC-------SAPRPMTP 274 +++ ++ RLRDEL++ + DEA + +++ +AE+ + R S + Sbjct: 207 AQKHASEMMRLRDELNQLMVQADEAKNQMRQSHMAEIEEMNRKMAREYQKIESLRADLEG 266 Query: 275 XQTSPG*EPRRQPRTIADSTEGLAAQ------GDREAGDSGHGAAL*RPTQG-TGRSERT 433 S E Q + + D E + EA + QG T R E T Sbjct: 267 AHNSSAQEHAHQLQELRDEMEQQRVTLRKGHLAELEALKVDFERRMVETEQGYTDRIEET 326 Query: 434 PPKSRRQIQDDHIRHGGRVKPATA----KVTTEEQRWAQQLADKQRELDELRQRTVSQMQ 601 K + + ++H ++ TA ++ T + + AQ D +++ ELRQ+ + Sbjct: 327 RAKFEEEKLNKEMQHVRELEQLTADIENRLLTRDGKHAQHEKDLEKQFLELRQKLEGKYY 386 Query: 602 KKIDSLQEEL 631 ++DS + L Sbjct: 387 DELDSTVKNL 396 >SB_36821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1503 Score = 31.9 bits (69), Expect = 0.52 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +2 Query: 548 DKQRELDELR-QRTVSQMQKKIDSLQEELAQAKS 646 DK+REL ELR Q + +M +ID LQ E Q S Sbjct: 171 DKERELKELREQGNIDEMNAEIDRLQAEKRQVDS 204 >SB_42146| Best HMM Match : GYF (HMM E-Value=5.7e-15) Length = 924 Score = 30.7 bits (66), Expect = 1.2 Identities = 35/152 (23%), Positives = 61/152 (40%), Gaps = 3/152 (1%) Frame = +2 Query: 251 SAPRPMTPXQTSPG*-EPRRQPRTIADSTEGLAAQGDREAGDSGHGAAL*RPTQGTGRSE 427 S P +P S G P P T A + D EA + +L Q R E Sbjct: 519 SGPTQTSPSMMSAGPWSPANSPPTTATPSTPPVNVWDLEANNKSKVQSL----QEIQRIE 574 Query: 428 RTPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQ--LADKQRELDELRQRTVSQMQ 601 K R+ ++ + R + K EE+R QQ L +QRE +E+R++ +Q Sbjct: 575 EE--KERKTLEKE--RREAEARALQQKQQEEEERRRQQELLLQRQREEEEMRRQQEQMLQ 630 Query: 602 KKIDSLQEELAQAKSARHNHTFADAERLAEER 697 ++ + + Q ++ R + + E++ Sbjct: 631 RQREEEERRRQQEEAERQRREQEEVFKQQEQQ 662 >SB_39966| Best HMM Match : CRA_rpt (HMM E-Value=8.6) Length = 159 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/71 (23%), Positives = 33/71 (46%), Gaps = 3/71 (4%) Frame = +2 Query: 491 KPATAKVTTEEQRWAQQLADKQRELD---ELRQRTVSQMQKKIDSLQEELAQAKSARHNH 661 K K EE++W Q+ +K+ E + E + + +KK + +E+ Q ++ + Sbjct: 37 KETKKKTEKEEEKWKQEETEKEAETEKEAETEKEAEKEKKKKTEKEEEKGKQEETGKEAE 96 Query: 662 TFADAERLAEE 694 T AE +E Sbjct: 97 TEKQAETEKQE 107 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 30.7 bits (66), Expect = 1.2 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = +2 Query: 506 KVTTEEQRWAQQLADK-QRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHTFADAER 682 + +E AQQ A+K Q+ + EL Q+T + K + ++++++ +S R N+ A+ E Sbjct: 2295 RALNDELYEAQQKAEKLQQTVSEL-QQTADEHSKDLHDTRKKISELESDR-NNLMAENEN 2352 Query: 683 LAEERL 700 L EE L Sbjct: 2353 LKEELL 2358 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/68 (26%), Positives = 38/68 (55%) Frame = +2 Query: 440 KSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSL 619 +S R+++D RH + ++ EE + Q LA Q+E+D+ ++ + ++ SL Sbjct: 4242 RSLRELKD---RHAAELSARGNNMSPEELQ--QLLAQHQQEVDDAMEKLDADRSRQQSSL 4296 Query: 620 QEELAQAK 643 Q++LA+ + Sbjct: 4297 QQKLAEKR 4304 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 30.3 bits (65), Expect = 1.6 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +2 Query: 515 TEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHT 664 +E+ R+ +Q D +RE + LRQ+ VS M+ K ++ EEL Q N + Sbjct: 2674 SEKYRFQKQREDCEREKEHLRQQ-VSLMRSKGNTQSEELIQQMRELQNQS 2722 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +2 Query: 92 ELESAQGSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQLA 220 +L+++Q + + QLERLR+EL R K +E A E + A Sbjct: 256 QLQNSQKQRDDLKRQLERLREELKRSKDSMNEVRRDALEQKKA 298 Score = 29.9 bits (64), Expect = 2.1 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = +2 Query: 506 KVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHT 664 K+ + R+ +Q D +RE + LRQ+ VS M+ K ++ EEL Q N + Sbjct: 2623 KLRNQNVRFEKQREDCEREKEHLRQQ-VSLMRSKGNTQSEELIQQMRELQNQS 2674 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +2 Query: 533 AQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHN 658 A AD RE +R + ++ +ID+L++E+ + K+ R+N Sbjct: 1007 ANVAADAAREEKRDMERKFNSLKDRIDALEKEIKELKAQRNN 1048 >SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1079 Score = 30.3 bits (65), Expect = 1.6 Identities = 22/85 (25%), Positives = 39/85 (45%) Frame = +2 Query: 437 PKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDS 616 P SRR + DH+ V A VT R + + +++E+D L R + Q D Sbjct: 987 PSSRRTSETDHVTGQNHVITADVHVTDARDRDVRSESTEKQEMDVL-DRMIDQ-----DH 1040 Query: 617 LQEELAQAKSARHNHTFADAERLAE 691 + + Q +A+H+ + A + + E Sbjct: 1041 MTQAGTQPTTAKHHGSKARLQEMFE 1065 >SB_29515| Best HMM Match : TolA (HMM E-Value=0.031) Length = 592 Score = 30.3 bits (65), Expect = 1.6 Identities = 40/191 (20%), Positives = 81/191 (42%), Gaps = 2/191 (1%) Frame = +2 Query: 122 EQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAAVLRSACSAPRPMTPXQTSPG*EP 301 E+ ++ + R+E HK + A + +E + A+ A +A R + E Sbjct: 296 EEAEKEAKAREEEEAHKEA-ELAKQREKEARAAKRAEERAAAAEKRRQEVERKRREREEA 354 Query: 302 RRQPRTIADSTEGLAAQGDREAGDSGHGAAL*RPTQGTGRSERTPPKSRRQIQDDHIRHG 481 +R+ A+ E + + + E + + R +R + R+ +++ R+ Sbjct: 355 KRKQLEEAERLERVRLEAEEEM----------KRREEERRKKREEAERERKRKEEEERN- 403 Query: 482 GRVKPATAKVTTEEQRWAQQLADKQRELDELR--QRTVSQMQKKIDSLQEELAQAKSARH 655 R K A++ E+R + K++EL R + + + Q+KID EE A+ + Sbjct: 404 -REKQEKARLE-REKRMREDFERKKQELIAQRKLEEEIRREQEKIDRELEEAARREEEER 461 Query: 656 NHTFADAERLA 688 ++ERLA Sbjct: 462 IRNMEESERLA 472 >SB_23387| Best HMM Match : REX1 (HMM E-Value=0.11) Length = 1011 Score = 30.3 bits (65), Expect = 1.6 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 92 ELESAQGSSREQRDQLERLRDELHRHKHKNDEA 190 ELE +G E+R+ ERLR+EL K+ EA Sbjct: 972 ELEKLKGQLMEEREVAERLREELGYDKNSRYEA 1004 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 30.3 bits (65), Expect = 1.6 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = +2 Query: 449 RQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEE 628 R+ QDD + R + + + + QQ+AD+ EL+ RQ S Q +D ++ Sbjct: 185 RKAQDDCEKEVNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELESVRQSYVDETEKS 244 Query: 629 LAQ 637 Q Sbjct: 245 AKQ 247 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 30.3 bits (65), Expect = 1.6 Identities = 44/214 (20%), Positives = 86/214 (40%), Gaps = 11/214 (5%) Frame = +2 Query: 92 ELESAQGSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAAVLRSACSAPRPMT 271 EL S + + +D+ E L+DEL + + +ND K +E + AE+ + R + + Sbjct: 670 ELASTKRHIADLQDKHEALKDELDKTEDENDALRDKKKELE-AEIEELKRKLAESELNI- 727 Query: 272 PXQTSPG*EPRRQPRTIADSTEGLAAQGDREAGDSGH-------GAAL*RPTQGTGRSER 430 P +QP A + + + + D + GDS +L + Sbjct: 728 ---------PIQQPIVEAQNVQIVQSSPDFDFGDSDELRRLQEDNISLRHKNSELEAESK 778 Query: 431 TPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQR---WAQQLADKQRELDELRQRTVSQMQ 601 R+ + D + G++ +++ QR + L + +EL L + + Sbjct: 779 LADDKRKDLNDQLVGCHGKISKLESQLNVANQRKFELEKALDEANKELKPLSDK-YDRAS 837 Query: 602 KKIDSLQEELAQAKSARHNHTFA-DAERLAEERL 700 + +D LQ+ L +S N DAE +++L Sbjct: 838 RDLDILQKTLDDTQSRLANAEMTLDAETSKKKQL 871 >SB_52732| Best HMM Match : M (HMM E-Value=0.019) Length = 1366 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/84 (17%), Positives = 35/84 (41%) Frame = +2 Query: 446 RRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQE 625 ++Q++ H ++ ++ +EQR ++A+ +R E Q+ +K +QE Sbjct: 453 KQQLEQQEADHQSTIRMLQDQILAKEQRLVAEIAEVERSYMETEHMLREQLDEKTSIIQE 512 Query: 626 ELAQAKSARHNHTFADAERLAEER 697 + +F E+ +R Sbjct: 513 LRKGVEDLAFKESFIGKEKSGLDR 536 >SB_7558| Best HMM Match : TPR_MLP1_2 (HMM E-Value=2.2) Length = 299 Score = 29.9 bits (64), Expect = 2.1 Identities = 21/74 (28%), Positives = 37/74 (50%) Frame = +3 Query: 351 KETEKQATVVTAPPSDDRLKELADQNEHLQSLVDKYKTIIYDTEGVLSRLQQK*RQRNSD 530 K+T ++ T V+ P SD + E+A+ N + +L ++ KT+ TE L R++ + Sbjct: 149 KDTCEKGTQVSHPTSDAKDLEIANLNHQVSALEEREKTL--RTEYNLLRVRYTDLMGQAS 206 Query: 531 GRNNSPTNSGNSMN 572 N P +S N Sbjct: 207 QPNEDPRSSNTVPN 220 >SB_2495| Best HMM Match : Pox_A_type_inc (HMM E-Value=8.2e-11) Length = 2024 Score = 29.9 bits (64), Expect = 2.1 Identities = 19/64 (29%), Positives = 32/64 (50%) Frame = +2 Query: 500 TAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHTFADAE 679 T V+ + + L +K +L +LR S ++KK+ SLQ+E+ AK + + AE Sbjct: 696 TQNVSIIQSHSDKSLMEKDYQLVQLRAEKAS-LEKKVKSLQKEIQFAKYEQDRYVKIQAE 754 Query: 680 RLAE 691 E Sbjct: 755 TAKE 758 >SB_51222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2520 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +2 Query: 521 EQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAK 643 E + + L QRE++E+R ++MQ+ ++ ELAQ K Sbjct: 1126 ENNFKEILETHQREMEEIRNSHENKMQEMAENHASELAQMK 1166 >SB_6600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/56 (32%), Positives = 28/56 (50%) Frame = +2 Query: 440 KSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKK 607 K RR+ D R GG + T K E ++W Q+ +QR + RQR + ++K Sbjct: 156 KWRREGSGDRERSGGEKEVETEKEVEERRKWRQRRKWRQRR--KWRQRRKWRQRRK 209 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +2 Query: 83 AAHELESAQGSSREQRDQLERLRDELHR 166 AA E + ++E RD LERL DE+HR Sbjct: 1916 AAQEADVDTTHTQEARDVLERLCDEIHR 1943 >SB_27532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 649 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/67 (19%), Positives = 30/67 (44%) Frame = +2 Query: 488 VKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHTF 667 ++ +V ++ + + +DE+ + + +++KK L E +QAK+ + Sbjct: 228 IEKTRKRVEVTQELVGSNAREMEARIDEIIDQKIRELEKKRARLHESASQAKNEKLKQLL 287 Query: 668 ADAERLA 688 E LA Sbjct: 288 VQGEELA 294 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/71 (22%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +2 Query: 425 ERTPPKSRR--QIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQM 598 ER+ +++R +Q+ H++ +K K EE++ ++ +KQR ++ ++R + Sbjct: 81 ERSKQEAQRLLALQEQHLKEEQEIKNEVEKERQEEEKRRMEI-EKQR-MESEKKRILESK 138 Query: 599 QKKIDSLQEEL 631 QK+I+ ++ + Sbjct: 139 QKRIEESKDTI 149 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 29.1 bits (62), Expect = 3.6 Identities = 21/89 (23%), Positives = 40/89 (44%) Frame = +2 Query: 416 GRSERTPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQ 595 G S RTP + I +DH+ V P T +R AQ ++ + + ++ S+ Sbjct: 1456 GASSRTPRIPKSSIDEDHLSKETEV-PDNGGRETRSKRRAQNAPEEDKTVKRTLRKRTSE 1514 Query: 596 MQKKIDSLQEELAQAKSARHNHTFADAER 682 K+ + + Q +++R + A AE+ Sbjct: 1515 PTKQ---YEPKTKQTRTSRRAKSPAGAEK 1540 >SB_45073| Best HMM Match : ERM (HMM E-Value=0) Length = 504 Score = 29.1 bits (62), Expect = 3.6 Identities = 19/75 (25%), Positives = 39/75 (52%), Gaps = 4/75 (5%) Frame = +2 Query: 428 RTPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQREL----DELRQRTVSQ 595 RT ++ R++ ++ ++ K EE+R ++L +K+R+L EL ++ V + Sbjct: 307 RTKAENDRKLLEEKLKQSEAEKEEMRAAQEEERRIKEEL-EKERKLIEQNRELLEKRVQE 365 Query: 596 MQKKIDSLQEELAQA 640 + + LQEE +A Sbjct: 366 QEAETQRLQEEFERA 380 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +2 Query: 518 EEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHT 664 E+QR Q+ ++K++EL Q+ V + ++ ++E+AQA R HT Sbjct: 367 EDQR-KQEQSEKEKEL----QKQVEHLTTRLKFQEQEIAQAMEQRKKHT 410 >SB_26950| Best HMM Match : TBC (HMM E-Value=5.2e-28) Length = 998 Score = 29.1 bits (62), Expect = 3.6 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 633 RRPNQRDTITRSPTPSVSP 689 RR + DTIT SPTPS++P Sbjct: 355 RRSHTLDTITTSPTPSLTP 373 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 29.1 bits (62), Expect = 3.6 Identities = 16/71 (22%), Positives = 40/71 (56%), Gaps = 2/71 (2%) Frame = +2 Query: 425 ERTPPKSRR--QIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQM 598 ER+ +++R +Q+ H++ +K K EE++ ++ +KQR ++ ++R + Sbjct: 199 ERSKQEAQRLLALQEQHLKEEQEIKNEVEKERQEEEKRRMEI-EKQR-MESEKKRILESK 256 Query: 599 QKKIDSLQEEL 631 QK+I+ ++ + Sbjct: 257 QKRIEESKDTI 267 >SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 806 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 500 TAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQK---KIDSLQEELAQAKSAR 652 +AK + RW + D+ RE+D + QM + ++D+L+ E+A ++ R Sbjct: 563 SAKARQDISRWQVETEDRLREVDSKMRPLPDQMTRLKAELDALRAEMALKEATR 616 >SB_39219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1951 Score = 28.7 bits (61), Expect = 4.8 Identities = 24/96 (25%), Positives = 40/96 (41%), Gaps = 3/96 (3%) Frame = +2 Query: 95 LESAQGSSREQRDQLERLRDELHRHKHKNDEAVAKA---QETQLAEVAAVLRSACSAPRP 265 LE S + + +LE E KH ++ K +++ L ++ +V S+ A +P Sbjct: 707 LEEENKSLKCEISKLENRSTEGQTTKHPHEAGKGKGDVERKSVLEDIQSVEESSLEACQP 766 Query: 266 MTPXQTSPG*EPRRQPRTIADSTEGLAAQGDREAGD 373 T PG DS E + AQ +AG+ Sbjct: 767 SNQV-TMPGANANINKLNFTDSNENIGAQRREKAGE 801 >SB_30449| Best HMM Match : DUF566 (HMM E-Value=1.2) Length = 415 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/57 (22%), Positives = 26/57 (45%) Frame = +2 Query: 503 AKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHTFAD 673 A+ + +A +Q++ E ++ + Q Q + LQE L ++ +H H D Sbjct: 206 AQAQLNQYNYANAQQQQQQQFQEFQREMMMQQQSMMFQLQEMLRVQQTVQHAHEVTD 262 >SB_10312| Best HMM Match : MpPF2 (HMM E-Value=0.26) Length = 522 Score = 28.7 bits (61), Expect = 4.8 Identities = 17/51 (33%), Positives = 31/51 (60%) Frame = +2 Query: 92 ELESAQGSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAAVLRS 244 E E A+ S+RE + L++L++EL + K D +A++T L E+ L++ Sbjct: 53 EAERAENSTRE--ESLQQLKEELEEVRMKGD--ADEAEKTALEEIVLNLKT 99 >SB_7332| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1894 Score = 28.7 bits (61), Expect = 4.8 Identities = 13/57 (22%), Positives = 26/57 (45%) Frame = +2 Query: 503 AKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNHTFAD 673 A+ + +A +Q++ E ++ + Q Q + LQE L ++ +H H D Sbjct: 851 AQAQLNQYNYANAQQQQQQQFQEFQREMMMQQQSMMFQLQEMLRVQQTVQHAHEVTD 907 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 28.7 bits (61), Expect = 4.8 Identities = 19/82 (23%), Positives = 35/82 (42%) Frame = +2 Query: 404 TQGTGRSERTPPKSRRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQR 583 +Q G TP S Q R R P + + + QQ A+ ++ +RQ+ Sbjct: 249 SQSGGSQRTTPAVSPYQSPSSSARSSPRGSPTASPSISRRRAKFQQQAEAAEGIEAVRQK 308 Query: 584 TVSQMQKKIDSLQEELAQAKSA 649 T++ ++ +EEL + + A Sbjct: 309 TLAGTFEERRKAREELRRLELA 330 >SB_58036| Best HMM Match : Cadherin (HMM E-Value=0) Length = 6074 Score = 28.7 bits (61), Expect = 4.8 Identities = 21/90 (23%), Positives = 38/90 (42%) Frame = +2 Query: 83 AAHELESAQGSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAAVLRSACSAPR 262 A ELE + +R LE L D+L + + + + A+ ++AA +A Sbjct: 218 ALSELEDKENENRRLTTDLEDLTDQLEQERKRITQHACPARRKLPTDLAAETSGTATARS 277 Query: 263 PMTPXQTSPG*EPRRQPRTIADSTEGLAAQ 352 Q + G ++P +I D+ + AQ Sbjct: 278 GRVCEQWTGGDPFAKRPSSIQDTQDPDNAQ 307 >SB_471| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 587 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -1 Query: 495 GLTRPPCRI*SSCICRRDFGGVRSDR 418 G P C + C C R FGG + DR Sbjct: 393 GSVSPDCDVTGHCTCTRGFGGRKCDR 418 >SB_48596| Best HMM Match : Filament (HMM E-Value=0.23) Length = 458 Score = 28.3 bits (60), Expect = 6.4 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +2 Query: 521 EQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSARHNH 661 E+R+A + + Q ++DELRQ + ++KI L++ L + R N+ Sbjct: 336 EERFASKEKNYQADIDELRQ-FEEKAKRKISELEDLLEKTTFDRENY 381 >SB_7395| Best HMM Match : SURF6 (HMM E-Value=1.8) Length = 1365 Score = 28.3 bits (60), Expect = 6.4 Identities = 22/89 (24%), Positives = 37/89 (41%) Frame = +2 Query: 110 GSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAAVLRSACSAPRPMTPXQTSP 289 G R+ + R E HR ++ A + + AE AVL + + +TP Sbjct: 1115 GRFRKSQRSRSRADREPHRGLGRDRRASVRRKSIAFAENKAVLETPVPTEKVITPK---- 1170 Query: 290 G*EPRRQPRTIADSTEGLAAQGDREAGDS 376 PR+QP T A + + E+G++ Sbjct: 1171 --PPRKQPSFSTSETIVEACEDEEESGNT 1197 >SB_56317| Best HMM Match : DUF1273 (HMM E-Value=1.2) Length = 475 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +2 Query: 185 EAVAKAQETQLAEVAAVLRSACSAPRPMTPXQTSPG*EPRRQPRTIADSTE 337 E++ K +++L ++ L S AP P T Q P PR+ R I E Sbjct: 4 ESLKKLSKSELIKLILELESNRPAPEPRTYEQRPPVPTPRKSVRQIVQGYE 54 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/34 (32%), Positives = 24/34 (70%) Frame = +3 Query: 393 SDDRLKELADQNEHLQSLVDKYKTIIYDTEGVLS 494 S+D + +L ++NEHL++++D ++ + + EG S Sbjct: 4608 SEDTIHQLVEENEHLRTVLDSHEDTVSE-EGEAS 4640 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +2 Query: 536 QQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKS 646 QQL + +++ E Q+ + + Q+KI LQE L + K+ Sbjct: 4786 QQLKQQYKQVQEQFQQQLHEQQQKIQLLQEVLERQKA 4822 >SB_22642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1574 Score = 28.3 bits (60), Expect = 6.4 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -1 Query: 459 CICRRDFGGVRSDR 418 CIC+R+ GGVR DR Sbjct: 1437 CICKRNVGGVRCDR 1450 >SB_5677| Best HMM Match : fn3 (HMM E-Value=0.0092) Length = 1146 Score = 28.3 bits (60), Expect = 6.4 Identities = 47/197 (23%), Positives = 78/197 (39%), Gaps = 22/197 (11%) Frame = +2 Query: 176 KNDEAVAKAQETQLAEVAAVLRSACSAP-RPMT----PXQTSPG*---------EPRRQP 313 +N AV +T++ EV A + P RP T P ++SPG P Sbjct: 537 RNPPAVLFVHDTEIEEVPAPVAKRSDIPSRPETMGGPPARSSPGGTNGLDKRSFRPTMAE 596 Query: 314 RTIAD--STEGLAAQGDREAGDSG---HGAAL*RPTQGTGRSERTPPKSRRQIQDDHIRH 478 R IA STE + + ++ D H AAL T + R+ T P I + Sbjct: 597 RVIAPPTSTERMTSFDKNQSLDCRLHPHRAALCVHTLRSTRNRSTYPT--HSISSQQPQQ 654 Query: 479 GGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKSAR-- 652 + + ++ QQ+A+KQ + L + Q+Q + Q++ Q + R Sbjct: 655 QPQQQQLNQLQQQHREKLQQQMAEKQHQESLLLLQKQQQLQHQQRIQQQQRLQQQQQRIQ 714 Query: 653 -HNHTFADAERLAEERL 700 H ++L +E+L Sbjct: 715 LHQEQLKQQQQLHQEQL 731 >SB_53535| Best HMM Match : zf-C2H2 (HMM E-Value=4.8e-32) Length = 323 Score = 27.9 bits (59), Expect = 8.4 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 98 ESAQGSSREQRDQLERLRDELHRHKHKNDEAVAK 199 E+A G ++ R LERL DEL + NDE +++ Sbjct: 117 ETASGKAKNAR--LERLDDELEKMLQGNDEIISR 148 >SB_47240| Best HMM Match : Pkinase_C (HMM E-Value=2.8e-06) Length = 619 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +2 Query: 89 HELESAQGSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAAVLRSACS 253 HE + +RE + LE+ D L ++D +A + +LAE ACS Sbjct: 303 HEATTLLDDAREAKRDLEKELDTLKPSVRRSDSVMALKRREELAEEIVSRIRACS 357 >SB_32407| Best HMM Match : WSC (HMM E-Value=0.0008) Length = 832 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Frame = +2 Query: 440 KSRRQIQDDHIRHGGRVKPATAKVTTEEQ---RWAQQLADKQRELDELRQRTVSQMQKKI 610 + RR + IRH ++ + EEQ R A Q+A + +L RQR ++ + I Sbjct: 326 RKRRAAKRARIRHEKLMRKLRLQQKMEEQRRRRRAHQIAQRLLKLKRERQRAGAKRRAAI 385 Query: 611 DSLQEELAQAKSARH 655 E+L + + H Sbjct: 386 RIRMEQLKRKRELEH 400 >SB_32300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 676 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +2 Query: 89 HELESAQGSSREQRDQLERLRDELHRHK 172 H L+ Q + +L+RLR ELH+H+ Sbjct: 64 HVLQDLQSQLSAREHELDRLRAELHQHE 91 >SB_25942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1062 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +2 Query: 536 QQLADKQRELDELRQRTVSQMQKKIDSLQEELAQAKS--ARHNHTFADAERLAE 691 QQLADK+ ++ L Q +S Q+ + + E L +A++ A H + + + E Sbjct: 749 QQLADKEGDIKRLSQFLLSIPQEDLQNKSESLLKARAMVAFHRGCYQEVYNILE 802 >SB_12619| Best HMM Match : DUF837 (HMM E-Value=4.9) Length = 192 Score = 27.9 bits (59), Expect = 8.4 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 3/72 (4%) Frame = +3 Query: 351 KETEKQATVVTAPPSDDRLKELADQNEHLQSLVDKYKTIIYDTEGVLSR---LQQK*RQR 521 K+T ++ T V+ P S+ + E+A+ N + +L ++ KT+ + + R L + Q Sbjct: 52 KDTCEKGTQVSHPTSNAKDLEIANLNHQISALEEREKTLRTEYNLLRVRYTDLMGQASQP 111 Query: 522 NSDGRNNSPTNS 557 N D R+ +NS Sbjct: 112 NEDPRDADQSNS 123 >SB_2704| Best HMM Match : TP2 (HMM E-Value=6.9) Length = 351 Score = 27.9 bits (59), Expect = 8.4 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +2 Query: 89 HELESAQGSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQLAEVAAVLRSACSAPRP- 265 HE+E QGS+ Q D E+ EL + K + A+ A AA A + PRP Sbjct: 177 HEMEEPQGSTSAQPD--EQFAQELAQEPGKQHQEPART-PVAAAPAAARESRAPNRPRPD 233 Query: 266 MTPXQTSP 289 +T ++ P Sbjct: 234 LTLDESKP 241 >SB_52671| Best HMM Match : SPAN-X (HMM E-Value=2.6) Length = 172 Score = 27.9 bits (59), Expect = 8.4 Identities = 24/105 (22%), Positives = 45/105 (42%), Gaps = 2/105 (1%) Frame = +2 Query: 314 RTIADSTEGLAAQGDRE-AGDSGHGAAL*RPTQGTGRSERTPPKSRRQIQDDHIRHGGRV 490 R + ST+G ++ G E + D + R T + + +P + D+ R Sbjct: 57 RGTSRSTKGRSSSGQEENSTDFRTSSTDGRSTSSSAENFISPHCTNSSSDLDNKRLNANE 116 Query: 491 KPATA-KVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQ 622 + T + T E RW L D E + +R +++ ++ + SLQ Sbjct: 117 RQTTPERATNESLRWDNTLDDPNAEEERIRVYKMNRRKRYMASLQ 161 >SB_44957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1336 Score = 27.9 bits (59), Expect = 8.4 Identities = 22/101 (21%), Positives = 42/101 (41%), Gaps = 4/101 (3%) Frame = +2 Query: 338 GLAAQGDREAGDSGHGAAL*RPTQGTGRSERTPPKSRRQIQ----DDHIRHGGRVKPATA 505 G+A Q DR+ + H P PP + DDH HG + P+ Sbjct: 373 GIARQPDRDQCND-HAHVPYEPPDDHAHVPYEPPDDHAHVPYEPPDDHA-HGIELDPSKF 430 Query: 506 KVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEE 628 +V E+ Q+++DK + +L + + K + + +++ Sbjct: 431 EVDVEQVSHWQKVSDKIESVSQLEHAIAAVVLKNLRAQKKD 471 >SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1669 Score = 27.9 bits (59), Expect = 8.4 Identities = 21/73 (28%), Positives = 38/73 (52%), Gaps = 11/73 (15%) Frame = +2 Query: 488 VKPATAKVTTEEQRWAQQLADKQRELDELR----QRTVSQ-MQKK------IDSLQEELA 634 VK K TE +W Q++ ++++ D+LR R +++ +Q++ ID + ELA Sbjct: 373 VKLGVLKPVTEPTQWCSQISIQKKKNDQLRICLDPRVLNEALQREIYPLPTIDDILPELA 432 Query: 635 QAKSARHNHTFAD 673 AK + H+ D Sbjct: 433 NAKLFIYGHSEGD 445 >SB_29194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2916 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 101 SAQGSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQ 214 S Q +R+ Q+E L+++LH DEAV + Q Sbjct: 2162 SMQDQNRQASQQVESLQEQLHAISSHRDEAVMQLAAVQ 2199 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/62 (25%), Positives = 29/62 (46%) Frame = +2 Query: 458 QDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQMQKKIDSLQEELAQ 637 +D I G+V+ QR Q ++QR+ EL+Q+ Q Q++ Q + Q Sbjct: 1718 RDQQIEKEGKVREQQQLQEEGRQREQQNEQEQQRQQHELQQQQAEQRQRERSQQQGQPRQ 1777 Query: 638 AK 643 ++ Sbjct: 1778 SQ 1779 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +2 Query: 89 HELESAQGSSREQRDQLERLRDELHRHKHKNDEAVAKAQETQLAE 223 H+L+ + S RD LER++ E K + +E + ++ + AE Sbjct: 2847 HDLKETRKSLSGVRDDLERVKREARESKSQLEELRGRVEDLESAE 2891 >SB_2860| Best HMM Match : IncA (HMM E-Value=0.41) Length = 417 Score = 27.9 bits (59), Expect = 8.4 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = +2 Query: 446 RRQIQDDHIRHGGRVKPATAKVTTEEQRWAQQLADKQRELDELRQRTVSQM 598 + ++Q DH R +K A ++ + + K R+L++ +QR V Q+ Sbjct: 155 KEELQRDHERKMTELKEAARRMKEDCAHQVEMERSKVRDLEQQKQRLVEQL 205 >SB_227| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) Length = 1003 Score = 27.9 bits (59), Expect = 8.4 Identities = 16/62 (25%), Positives = 32/62 (51%), Gaps = 5/62 (8%) Frame = +2 Query: 119 REQRDQLERLRDELHRHKHKN--DEAVAKAQ---ETQLAEVAAVLRSACSAPRPMTPXQT 283 ++Q++++E L+ EL H+ +E + + +T L + A +R P +TP T Sbjct: 65 KDQKEKMEELKQELDVDWHRITVEELMTRLDTNVQTGLTDEEAAIRLKRDGPNALTPTPT 124 Query: 284 SP 289 +P Sbjct: 125 TP 126 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,878,089 Number of Sequences: 59808 Number of extensions: 234815 Number of successful extensions: 1623 Number of sequences better than 10.0: 67 Number of HSP's better than 10.0 without gapping: 1351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1597 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -