BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0349.Seq (828 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) 72 7e-13 SB_2286| Best HMM Match : Cu_bind_like (HMM E-Value=6.6) 30 2.6 SB_49228| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_45746| Best HMM Match : FA_desaturase (HMM E-Value=0) 29 3.5 SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) 29 6.1 SB_36820| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) 28 8.0 SB_3750| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 268 Score = 71.7 bits (168), Expect = 7e-13 Identities = 33/62 (53%), Positives = 39/62 (62%) Frame = +1 Query: 37 TFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLKTASANIIEKRALR 216 T GEG+HNYHH FP DY A E G R +N++TR ID +A MG D K I KR +R Sbjct: 196 TSGEGYHNYHHTFPQDYAASEFGTR-LNMSTRLIDMWAAMGLVSDRKVVPKETIRKRMMR 254 Query: 217 TG 222 TG Sbjct: 255 TG 256 >SB_2286| Best HMM Match : Cu_bind_like (HMM E-Value=6.6) Length = 326 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +1 Query: 19 GMANAFTF--GEGFHNYHHVFPWDYRADE 99 G+ + F F GEG+HN H + +D ADE Sbjct: 115 GLGDVFVFYPGEGYHNVHVIRGYDTAADE 143 >SB_49228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%) Frame = +1 Query: 19 GMANAFTF--GEGFHNYHHVFPWDYRADELG 105 G+ + F F GEG+ N H + +D ADE+G Sbjct: 208 GLGDVFVFYPGEGYRNVHVIRGYDTAADEVG 238 >SB_45746| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 331 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +1 Query: 19 GMANAFTFGEGFHNYHHVFP 78 G N TF G+HN HH FP Sbjct: 247 GPLNYLTFNVGYHNEHHDFP 266 >SB_55414| Best HMM Match : 7tm_1 (HMM E-Value=4.3e-08) Length = 595 Score = 28.7 bits (61), Expect = 6.1 Identities = 21/66 (31%), Positives = 31/66 (46%), Gaps = 6/66 (9%) Frame = +3 Query: 393 VGNFCIGFYCIHLNLYIFLLVLSQILKLIIGYKRNITLSHKRV------KFPSFVTVILL 554 VG C+ Y + LY+ + V Q +G KR L+ KR+ F FVT ++L Sbjct: 405 VGVLCVMIYLTSVGLYVRIYVFVQKASSQLGVKREARLA-KRISLMVLTNFFFFVTPMIL 463 Query: 555 SKAFVY 572 +VY Sbjct: 464 FLIYVY 469 >SB_36820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +1 Query: 19 GMANAFTF--GEGFHNYHHVFPWDYRADE 99 G+ N F F GEG+ N H + +D ADE Sbjct: 65 GLGNVFVFYPGEGYRNVHVIRGYDTAADE 93 >SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) Length = 1667 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/29 (41%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +1 Query: 19 GMANAFTF--GEGFHNYHHVFPWDYRADE 99 G+++ F F GEG+ N H + +D ADE Sbjct: 124 GLSDVFVFYPGEGYRNVHVILGYDTAADE 152 >SB_3750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +1 Query: 19 GMANAFTF--GEGFHNYHHVFPWDYRADELGDRY 114 G+ + F F GEG+ N H + +D ADE Y Sbjct: 93 GLGDVFVFYPGEGYRNVHVIRGYDTAADEYPSHY 126 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,722,510 Number of Sequences: 59808 Number of extensions: 445233 Number of successful extensions: 1104 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1102 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2323539746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -