BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0349.Seq (828 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g15850.1 68416.m02005 fatty acid desaturase family protein si... 34 0.10 At1g06090.1 68414.m00638 fatty acid desaturase family protein si... 34 0.10 At1g06360.1 68414.m00672 fatty acid desaturase family protein si... 34 0.13 At1g06350.1 68414.m00671 fatty acid desaturase family protein si... 34 0.13 At1g06120.1 68414.m00641 fatty acid desaturase family protein si... 34 0.13 At2g31360.1 68415.m03831 delta 9 desaturase (ADS2) identical to ... 33 0.23 At1g06080.1 68414.m00637 delta 9 desaturase (ADS1) identical to ... 32 0.53 At3g15870.1 68416.m02007 fatty acid desaturase family protein si... 31 0.71 At1g06100.1 68414.m00639 fatty acid desaturase family protein si... 30 1.6 At1g74960.2 68414.m08700 3-ketoacyl-ACP synthase, putative simil... 29 5.0 At1g74960.1 68414.m08699 3-ketoacyl-ACP synthase, putative simil... 29 5.0 At4g04930.1 68417.m00717 fatty acid desaturase family protein si... 28 8.7 >At3g15850.1 68416.m02005 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 371 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +1 Query: 31 AFTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLKTAS 186 A FGEG+HN HH F + R L +++T + F +G A D+K S Sbjct: 309 ALAFGEGWHNNHHAFEFSAR-HGLEWWQLDMTWYVVKFLQAIGLATDVKLPS 359 >At1g06090.1 68414.m00638 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase GB:BAA25180 GI:2970034 (ADS1) from [Arabidopsis thaliana] Length = 299 Score = 34.3 bits (75), Expect = 0.10 Identities = 20/48 (41%), Positives = 25/48 (52%) Frame = +1 Query: 34 FTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLK 177 FT GE +HN HH F R L ++LT I FF +G A D+K Sbjct: 239 FTMGESWHNNHHAFEASAR-HGLEWYQVDLTWYLICFFQALGLATDVK 285 >At1g06360.1 68414.m00672 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 299 Score = 33.9 bits (74), Expect = 0.13 Identities = 23/60 (38%), Positives = 29/60 (48%) Frame = +1 Query: 34 FTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLKTASANIIEKRAL 213 FT GE +HN HH F R L I++T I F +G A D+K S +K AL Sbjct: 239 FTMGESWHNNHHAFESSAR-QGLEWWQIDITWYLIRLFEVLGLATDVKLPSEIQKQKLAL 297 >At1g06350.1 68414.m00671 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 300 Score = 33.9 bits (74), Expect = 0.13 Identities = 23/60 (38%), Positives = 29/60 (48%) Frame = +1 Query: 34 FTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLKTASANIIEKRAL 213 FT GE +HN HH F R L I++T I F +G A D+K S +K AL Sbjct: 240 FTMGESWHNNHHAFESSAR-QGLEWWQIDITWYLIRLFEVLGIATDVKLPSELQKQKMAL 298 >At1g06120.1 68414.m00641 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase GB:BAA25180 GI:2970034 (ADS1) from [Arabidopsis thaliana]; supported by cDNA:gi_12083275_gb_AF332434.1_AF332434 Length = 299 Score = 33.9 bits (74), Expect = 0.13 Identities = 20/48 (41%), Positives = 25/48 (52%) Frame = +1 Query: 34 FTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLK 177 FT GE +HN HH F R L ++LT I FF +G A D+K Sbjct: 239 FTMGESWHNNHHAFEASAR-HGLEWYQVDLTWYLIWFFQVLGLATDVK 285 >At2g31360.1 68415.m03831 delta 9 desaturase (ADS2) identical to delta 9 acyl-lipid desaturase (ADS2) GI:2970036 from [Arabidopsis thaliana] Length = 307 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +1 Query: 28 NAFTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLK 177 + F+FGE +HN HH F R L I+++ + FF +G A D+K Sbjct: 245 SVFSFGESWHNNHHAFESSAR-QGLEWWQIDISWYIVRFFEIIGLATDVK 293 >At1g06080.1 68414.m00637 delta 9 desaturase (ADS1) identical to delta 9 acyl-lipid desaturase (ADS1) GB:BAA25180 GI:2970034 from [Arabidopsis thaliana] Length = 305 Score = 31.9 bits (69), Expect = 0.53 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +1 Query: 28 NAFTFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLKTASANIIEKR 207 + F+FGE +HN HH F R L I+++ + F +G A D+K S + + Sbjct: 243 SVFSFGESWHNNHHAFESSAR-QGLEWWQIDISWYIVRFLEIIGLATDVKLPSESQRRRM 301 Query: 208 AL 213 A+ Sbjct: 302 AM 303 >At3g15870.1 68416.m02007 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 292 Score = 31.5 bits (68), Expect = 0.71 Identities = 19/59 (32%), Positives = 31/59 (52%) Frame = +1 Query: 37 TFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLKTASANIIEKRAL 213 T GEG+HN HH F + R L +++T I F +G A ++K + ++ +AL Sbjct: 234 TLGEGWHNNHHAFEFSAR-HGLEWWQLDITWCLIRFLEAIGLATNVKLPTETQMKGKAL 291 >At1g06100.1 68414.m00639 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 299 Score = 30.3 bits (65), Expect = 1.6 Identities = 20/60 (33%), Positives = 29/60 (48%) Frame = +1 Query: 37 TFGEGFHNYHHVFPWDYRADELGDRYINLTTRFIDFFAWMGWAYDLKTASANIIEKRALR 216 T GE +HN HH F R L +++T I FF +G A ++K + K A+R Sbjct: 240 TMGESWHNNHHAFETSAR-HGLEWYQLDITWYLIWFFQALGLATNVKLPTDAQKRKMAIR 298 >At1g74960.2 68414.m08700 3-ketoacyl-ACP synthase, putative similar to 3-ketoacyl-ACP synthase [Cuphea pulcherrima] gi|3800747|gb|AAC68860; identical to cDNA beta-ketoacyl-ACP synthetase 2 nuclear gene for plastid product GI:14582700 Length = 541 Score = 28.7 bits (61), Expect = 5.0 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 802 CSEF*FRIIREIKNQFTEGATLQLL--LMTKFYIYLRRLG 689 CSEF RI EIK+ TEG L M KF +YL G Sbjct: 169 CSEFPTRIAGEIKSFSTEGWVAPKLSKRMDKFMLYLLTAG 208 >At1g74960.1 68414.m08699 3-ketoacyl-ACP synthase, putative similar to 3-ketoacyl-ACP synthase [Cuphea pulcherrima] gi|3800747|gb|AAC68860; identical to cDNA beta-ketoacyl-ACP synthetase 2 nuclear gene for plastid product GI:14582700 Length = 541 Score = 28.7 bits (61), Expect = 5.0 Identities = 19/40 (47%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -3 Query: 802 CSEF*FRIIREIKNQFTEGATLQLL--LMTKFYIYLRRLG 689 CSEF RI EIK+ TEG L M KF +YL G Sbjct: 169 CSEFPTRIAGEIKSFSTEGWVAPKLSKRMDKFMLYLLTAG 208 >At4g04930.1 68417.m00717 fatty acid desaturase family protein similar to D. melanogaster Des-1 protein, GenBank accession number X94180; contains Pfam profile PF00487 Fatty acid desaturase domain Length = 332 Score = 27.9 bits (59), Expect = 8.7 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 19 GMANAFTFGEGFHNYHHVFP 78 G N T+ G+HN HH FP Sbjct: 259 GPLNLLTWSVGYHNEHHDFP 278 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,241,142 Number of Sequences: 28952 Number of extensions: 325717 Number of successful extensions: 630 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1902108000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -