BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0348.Seq (775 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 3.6 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 23 3.6 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 4.7 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 8.3 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 8.3 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 3.6 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 694 RIRFVNF*MQIYCL*GRPHNRRFFLHYVYICSFLY*LSK 578 +IRF+N +++ GR NRR F+ + IC LSK Sbjct: 198 QIRFLNQYLRLKPE-GRISNRRVFISFSKICYLHQHLSK 235 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 22.6 bits (46), Expect = 3.6 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 694 RIRFVNF*MQIYCL*GRPHNRRFFLHYVYICSFLY*LSK 578 +IRF+N +++ GR NRR F+ + IC LSK Sbjct: 216 QIRFLNQYLRLKPE-GRISNRRVFISFSKICYLHQHLSK 253 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -1 Query: 340 EKRTHGPLCGKNYERYIYLLKYL 272 EKR P+C K + R +L K++ Sbjct: 372 EKRFACPICNKRFMRSDHLAKHV 394 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/49 (20%), Positives = 24/49 (48%) Frame = +1 Query: 628 IVYCVVFLTDNIFAFKNLQILFFITNFQRAFKNLFYLLYSNSEFTLSVV 774 +V+C++ + + + I+ F T R N+F + S ++ + +V Sbjct: 72 MVFCIIIMCLGVIGNVMVPIVIFKTKDMRNSTNIFLVNLSVADLMVLLV 120 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.4 bits (43), Expect = 8.3 Identities = 10/49 (20%), Positives = 24/49 (48%) Frame = +1 Query: 628 IVYCVVFLTDNIFAFKNLQILFFITNFQRAFKNLFYLLYSNSEFTLSVV 774 +V+C++ + + + I+ F T R N+F + S ++ + +V Sbjct: 72 MVFCIIIMCLGVIGNVMVPIVIFKTKDMRNSTNIFLVNLSVADLMVLLV 120 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,661 Number of Sequences: 336 Number of extensions: 3867 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -