BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0348.Seq (775 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) 28 9.6 >SB_42213| Best HMM Match : ABC_tran (HMM E-Value=4.30058e-42) Length = 1264 Score = 27.9 bits (59), Expect = 9.6 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 6/73 (8%) Frame = +1 Query: 541 YRRISVAIRSDLISRV------NIETNKYIHSEERIVYCVVFLTDNIFAFKNLQILFFIT 702 Y+++ V+ RSDL SRV N+ +N E+ I+Y ++FL + ++ +L + Sbjct: 224 YKKVLVSSRSDL-SRVTGGYVMNLISNDVRRVEKSIMYMLIFLKIFVDIVSSVAVLSVLV 282 Query: 703 NFQRAFKNLFYLL 741 +Q + +LL Sbjct: 283 GWQSLIGLVLFLL 295 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,335,767 Number of Sequences: 59808 Number of extensions: 437696 Number of successful extensions: 2759 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2712 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2759 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -