BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0343.Seq (624 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.68 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.68 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.68 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.68 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 22 4.8 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 8.4 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.68 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +1 Query: 352 SVLAPSAFFMCETIKSLELIFRGENTSSIFFILLPITLYML 474 ++L P F+ + + F+ +N +S ++ ++PI +ML Sbjct: 920 TILGPGTIFLM-LVGAFVAAFQIDNWTSFYYNIIPILFFML 959 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.68 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +1 Query: 352 SVLAPSAFFMCETIKSLELIFRGENTSSIFFILLPITLYML 474 ++L P F+ + + F+ +N +S ++ ++PI +ML Sbjct: 920 TILGPGTIFLM-LVGAFVAAFQIDNWTSFYYNIIPILFFML 959 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.68 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +1 Query: 352 SVLAPSAFFMCETIKSLELIFRGENTSSIFFILLPITLYML 474 ++L P F+ + + F+ +N +S ++ ++PI +ML Sbjct: 920 TILGPGTIFLM-LVGAFVAAFQIDNWTSFYYNIIPILFFML 959 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 24.6 bits (51), Expect = 0.68 Identities = 10/41 (24%), Positives = 23/41 (56%) Frame = +1 Query: 352 SVLAPSAFFMCETIKSLELIFRGENTSSIFFILLPITLYML 474 ++L P F+ + + F+ +N +S ++ ++PI +ML Sbjct: 920 TILGPGTIFLM-LVGAFVAAFQIDNWTSFYYNIIPILFFML 959 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.8 bits (44), Expect = 4.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +1 Query: 475 HDFLM*SGCEDLILLTCDTK 534 H FL+ +G + + TCD K Sbjct: 763 HPFLIPTGFDSCTVCTCDAK 782 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.0 bits (42), Expect = 8.4 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +2 Query: 203 TRHLTVWNANSDAPVCEG 256 TR+ T WN + +C G Sbjct: 113 TRYWTCWNGTATEQLCIG 130 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,492 Number of Sequences: 336 Number of extensions: 2674 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -