BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0341.Seq (727 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 23 3.3 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 7.7 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 21 7.7 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 22.6 bits (46), Expect = 3.3 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +3 Query: 33 PALQGYRRCLRPYP 74 P + YR C RPYP Sbjct: 251 PYVPFYRYCYRPYP 264 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 7.7 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +2 Query: 416 FRCVRARYHHLPC 454 + C R HH+PC Sbjct: 935 YMCEGERKHHMPC 947 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.4 bits (43), Expect = 7.7 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 33 PALQGYRRCLRPYPQGAGSPFILAW*LRQRHQVLPDPGAQLR 158 P+L R L PYPQ + ++ + L Q +Q+ A +R Sbjct: 27 PSLSDTRPML-PYPQNYINSYLFSLSLAQNNQLFTHHKAPIR 67 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,329 Number of Sequences: 336 Number of extensions: 3154 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -