BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0329.Seq (580 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC839.06 |cta3||P-type ATPase, calcium transporting Cta3|Schiz... 27 2.0 SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3||... 26 3.5 >SPBC839.06 |cta3||P-type ATPase, calcium transporting Cta3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1037 Score = 27.1 bits (57), Expect = 2.0 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +3 Query: 345 VDMSGSTNPTSMTVSGQPAALQ 410 VD S + NPT TVSG AA+Q Sbjct: 393 VDTSDANNPTIGTVSGLEAAMQ 414 >SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3|||Manual Length = 1315 Score = 26.2 bits (55), Expect = 3.5 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = -3 Query: 536 LFIILALAPSLSASQPYYTKHIRRASSSLGVKRSLIP 426 L IIL +A + S+PY+ +R +++L KR L P Sbjct: 1105 LVIILPIAVFMGRSRPYHRLAHKRPTANLVSKRILSP 1141 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,916,238 Number of Sequences: 5004 Number of extensions: 32248 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -