BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0319.Seq (806 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) 46 5e-05 SB_35388| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 >SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) Length = 858 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +3 Query: 135 EVVGERLPYDNQTRSTARMSEITPXLVAYGDVQDNNYFA 251 E+ G+ LPY+ Q RM+EI P L YGDV+ N+F+ Sbjct: 170 EIAGQTLPYETQEEIRRRMTEIAPNLTRYGDVEQANFFS 208 >SB_35388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 29.1 bits (62), Expect = 4.4 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = +3 Query: 69 TLLAVSPXGKARDDWKIIRTLSEVVGERLPYDNQTRSTARM-SEITPXLVAYG 224 T+L ++P K+ D IRTL+ ++ +R PY +R + TP L+ G Sbjct: 16 TVLTLTPLKKSLVDLTWIRTLARLLEKRSPYHGAIAPLSRYEGKTTPYLLRLG 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,472,668 Number of Sequences: 59808 Number of extensions: 426075 Number of successful extensions: 971 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 971 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2239700683 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -