BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0312.Seq (792 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-tran... 26 1.2 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 24 4.7 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 23 8.2 >AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-transferase D7 protein. Length = 218 Score = 26.2 bits (55), Expect = 1.2 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = -3 Query: 460 YKKYYEQFSKNLKLGIHEDSQNRAKLSELL 371 Y++ + + ++LG H D +AKL+E L Sbjct: 107 YQRVVDYYFPTIQLGAHLDQTKKAKLAEAL 136 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 24.2 bits (50), Expect = 4.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 486 KNWQRTKKTTRSIMNNSART*NWVSMK 406 +NW+ +K+T +I AR W S K Sbjct: 269 RNWEESKETETNINPTDARAPAWESDK 295 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.4 bits (48), Expect = 8.2 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 475 EDKENYKKYYEQFSKNLKLGIHED 404 ED+E +K+ QFSK + LGI D Sbjct: 214 EDEEAFKR---QFSKYISLGIKAD 234 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 708,506 Number of Sequences: 2352 Number of extensions: 12811 Number of successful extensions: 23 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83160600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -