BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0312.Seq (792 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 29 0.050 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 24 1.4 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 5.7 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 9.9 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 9.9 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 29.1 bits (62), Expect = 0.050 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +1 Query: 535 NFILLKHLT*NV*RKVLTVDNTSNEVKVLWDEILTVVHDENSSYIQLDIV 684 NF++ H T ++ ++ +T++E+ WD + +V DEN QL +V Sbjct: 166 NFLIYPHDTQECKLQMESLSHTTDEMIFQWDPDVPLVVDENIELPQLQLV 215 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -1 Query: 390 LSSLSFCGTTLQHRVMKPALSKS 322 L ++ CGTTLQ+R+ + L K+ Sbjct: 133 LITMELCGTTLQNRLDEAILIKN 155 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 119 LPL*PIQGSCHHTPSSVV 172 +PL P SCH TP S + Sbjct: 651 MPLLPRPISCHTTPDSFI 668 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 155 TPSSVVLHIHQWAQSCRLLHSHVSS 229 T ++V LH+ ++ Q LH+ +S+ Sbjct: 311 TGATVPLHMQKYVQMIHDLHTRIST 335 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 155 TPSSVVLHIHQWAQSCRLLHSHVSS 229 T ++V LH+ ++ Q LH+ +S+ Sbjct: 311 TGATVPLHMQKYVQMIHDLHTRIST 335 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,900 Number of Sequences: 438 Number of extensions: 3501 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -