BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0311.Seq (472 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 23 2.2 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 5.0 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 21 6.7 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 8.8 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 8.8 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 8.8 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 22.6 bits (46), Expect = 2.2 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 118 SSFFLRITNPSIIGESGMYSSVASSARSPKTAAPASCECGNRLLSSC 258 SS +L + N S Y S A+++ + + PAS +LS C Sbjct: 813 SSDYLMVGNSP--ASSPRYLSAAATSSTSTSPRPASSTAATLVLSGC 857 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 5.0 Identities = 6/13 (46%), Positives = 12/13 (92%) Frame = +3 Query: 129 LENHESLHYRRER 167 L NH+S+++RR++ Sbjct: 417 LNNHKSIYHRRQK 429 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.0 bits (42), Expect = 6.7 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = -3 Query: 293 WDRLWML 273 WDRLW+L Sbjct: 133 WDRLWVL 139 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.6 bits (41), Expect = 8.8 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 138 DSQEKRG*RHGLCSIKMYLSCNL 70 D +K+G G SI Y C L Sbjct: 779 DKSKKQGSSAGTSSITKYTGCEL 801 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 20.6 bits (41), Expect = 8.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 441 LVVLTAFLDCKTIILGKSHYLL 376 ++VLT L ++LG S Y L Sbjct: 183 VLVLTVTLSASAMVLGLSSYSL 204 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.6 bits (41), Expect = 8.8 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 138 DSQEKRG*RHGLCSIKMYLSCNL 70 D +K+G G SI Y C L Sbjct: 869 DKSKKQGSSAGTSSITKYTGCEL 891 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,334 Number of Sequences: 438 Number of extensions: 2401 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12682287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -