BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0307.Seq (732 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 25 2.4 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 3.2 AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. 24 4.2 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 24 5.6 AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 pr... 23 9.7 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 25.0 bits (52), Expect = 2.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -1 Query: 573 VPPQSNSPPGSVLEPDHAGVLKATSVSATSPLCTLG 466 +PP SNS P S PD A++ S++S L G Sbjct: 868 MPPSSNSSPSSYPSPDVVISGLASNNSSSSNLVAAG 903 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 24.6 bits (51), Expect = 3.2 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 2/37 (5%) Frame = +2 Query: 212 SHCPYLLSSETTAK--ERAWENQRGKKTLLSLTLVWH 316 S+CP++L SET +R E + + + +L LVW+ Sbjct: 904 SNCPHILPSETEIDNIQRVIELKSREGAVSTLGLVWN 940 >AY745229-1|AAU93509.1| 56|Anopheles gambiae glutaredoxin protein. Length = 56 Score = 24.2 bits (50), Expect = 4.2 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +2 Query: 482 GDVAETLVAFKTPA*SGSRTLPGGEFDWGGTSVKE 586 GD ++++ T A + R GG F GGT +K+ Sbjct: 10 GDEIQSVLGELTGARTVPRVFIGGNFVGGGTDIKK 44 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.8 bits (49), Expect = 5.6 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = -1 Query: 174 DEAFGYLKRVIVTPAVYPRLLEFLHV-DIQSTGQKSHC 64 D +F L RV TPA P +EFL + D + HC Sbjct: 635 DASFNRLTRV--TPATIPNSIEFLFLNDNHIVHVEPHC 670 >AY095933-1|AAM34435.1| 505|Anopheles gambiae cytochrome P450 protein. Length = 505 Score = 23.0 bits (47), Expect = 9.7 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 Query: 352 DRFARSSLKNHYFHCFITYSVGRKRC 429 DRFA ++ + H F+ + G + C Sbjct: 425 DRFALAATHARHTHAFLPFGDGPRNC 450 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 780,213 Number of Sequences: 2352 Number of extensions: 16071 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -