BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0307.Seq (732 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 27 0.18 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 23 3.9 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 5.2 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 6.8 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 6.8 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 6.8 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 21 9.0 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 9.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.0 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 27.1 bits (57), Expect = 0.18 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = -1 Query: 648 CPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAGVLKATSVSA 490 C +P S+ + L+ + + + Q NSP + P H+G +TS +A Sbjct: 30 CTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSGSSASTSPAA 82 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 22.6 bits (46), Expect = 3.9 Identities = 18/76 (23%), Positives = 31/76 (40%), Gaps = 4/76 (5%) Frame = -1 Query: 561 SNSPPGSVLEPDHAGVLKATSVSATSPLCTLG----TKHRAPADIIDRAPLPPNRVSNET 394 S++P GS P A S + C+LG T A + DR+ P+ ++ Sbjct: 148 SSAPTGSSCGPGAAAAAALLSKRRSVSECSLGTASSTSSTASSRNSDRSAGSPSVSESDE 207 Query: 393 MKVVVFQRRSRETISH 346 + V+ + +T H Sbjct: 208 VDVIGYTSNQSDTDDH 223 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +1 Query: 367 SSLKNHYFHCFITYSVGRK 423 SS +FHC+ GRK Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 346 VGDRFARSSLKNHYFHCFI 402 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 6.8 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +1 Query: 346 VGDRFARSSLKNHYFHCFI 402 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 6.8 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 374 SDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 264 +D R SP TP+ + Y +E+ + S F D+P Sbjct: 21 NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 21.4 bits (43), Expect = 9.0 Identities = 13/49 (26%), Positives = 21/49 (42%) Frame = -1 Query: 423 LPPNRVSNETMKVVVFQRRSRETISHLCYTSHVSLQCQTRVKLNRVFFP 277 +PP V K +V R+ E C ++ +QC + + FFP Sbjct: 97 MPPEEVV--IGKEIVAVCRNEEYTGDDCQKTYQYVQCHYKQNPEKFFFP 143 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 341 ATPLMSPYNARLESSSTGSSFP 276 A + SP + SSTGSS P Sbjct: 347 AKQMASPEPPKSSESSTGSSIP 368 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = +3 Query: 492 RKRSSPLKLPRDPVRGHCQAGSLTG 566 R SP+ + DP+ A +LTG Sbjct: 454 RSAESPMSVQVDPMAASVVAAALTG 478 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,655 Number of Sequences: 438 Number of extensions: 4663 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -