BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0304.Seq (662 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O96205 Cluster: Putative uncharacterized protein PFB056... 36 1.1 >UniRef50_O96205 Cluster: Putative uncharacterized protein PFB0560w; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein PFB0560w - Plasmodium falciparum (isolate 3D7) Length = 3990 Score = 35.5 bits (78), Expect = 1.1 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = -3 Query: 645 ENYFTPENSGYLSPRPFQVCEICRYQTHIILNEVAN*LS*ISATYYMRKTC-LDVTKNIL 469 ENY++ +NS YL + + C C ++ +EV N +Y+ K C DV KN Sbjct: 3240 ENYWSKQNSYYLHLKDIKKCRTCLNYQRLLFHEVIN-----LFVFYVYKFCNWDVLKNYF 3294 Query: 468 LYLIRLYQESQT*TSEHILDL 406 LI +E+ EH ++ Sbjct: 3295 DILINGSEEAIIKVLEHFRNI 3315 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 560,580,339 Number of Sequences: 1657284 Number of extensions: 9619881 Number of successful extensions: 13756 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 13384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13755 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 50413227838 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -