BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0304.Seq (662 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pomb... 27 3.2 SPCC1620.08 |||succinate-CoA ligase |Schizosaccharomyces pombe|c... 25 7.4 SPBC211.06 |gfh1||gamma tubulin complex subunit Gfh1|Schizosacch... 25 9.7 >SPBC1289.15 ||SPBC8E4.07c|glycoprotein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1283 Score = 26.6 bits (56), Expect = 3.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -2 Query: 634 YTREQRLPFTATVPGL*NM*VPNTHYSKRSSELTF 530 Y+ LP T T+ G + +P T Y+ +S L + Sbjct: 130 YSNTNSLPITDTINGTTELIIPTTSYNNQSHTLIY 164 >SPCC1620.08 |||succinate-CoA ligase |Schizosaccharomyces pombe|chr 3|||Manual Length = 433 Score = 25.4 bits (53), Expect = 7.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +2 Query: 404 PKSSICSLVYVCDSWYNRIKY 466 P IC++VYVC+ + R +Y Sbjct: 117 PAGKICNVVYVCERKFIRKEY 137 >SPBC211.06 |gfh1||gamma tubulin complex subunit Gfh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 25.0 bits (52), Expect = 9.7 Identities = 10/32 (31%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 57 CIEVI-TYQRFHKKKPSGSWLELKRIHLHCNC 149 C+ V T+Q+ H + L K++ L C C Sbjct: 141 CLSVASTFQKLHNMYMGSTHLNFKKLVLECEC 172 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,452,163 Number of Sequences: 5004 Number of extensions: 45456 Number of successful extensions: 80 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 301829700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -