BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0304.Seq (662 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44005| Best HMM Match : CUE (HMM E-Value=0.38) 29 4.5 SB_7254| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_44005| Best HMM Match : CUE (HMM E-Value=0.38) Length = 761 Score = 28.7 bits (61), Expect = 4.5 Identities = 15/32 (46%), Positives = 21/32 (65%) Frame = -1 Query: 434 RKLVNIYSTWART*ALLGLGEYFSRVPSNLVA 339 R+L+N+YS A A++GL +YF V S L A Sbjct: 471 RRLMNLYSKKALILAVMGLEKYFRFVHSTLQA 502 >SB_7254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 27.9 bits (59), Expect = 7.8 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 627 ENSGYLSPRPFQVCE-ICRYQTHIILNE 547 EN+ Y PF+VC IC +Q +++ E Sbjct: 137 ENTAYPDTLPFKVCRIICEFQYRLLIQE 164 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,420,803 Number of Sequences: 59808 Number of extensions: 313000 Number of successful extensions: 383 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 383 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -