BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0303.Seq (675 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 23 2.3 EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopre... 22 4.0 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 22 5.3 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 Query: 291 SRGMQVRGGAGQPTADAGG 235 S G+ G A PTA AGG Sbjct: 253 SFGLHATGSAPSPTAGAGG 271 >EF222296-1|ABN79656.2| 403|Tribolium castaneum arginine vasopressin receptor protein. Length = 403 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +1 Query: 10 SPRPFRQTDIMSQSHTGAFPTRYKRAPGAA 99 S RPF + + + + + +PTR P A Sbjct: 361 SLRPFSRWSLCNSARSNKYPTRVPHRPYVA 390 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 436 KLPA*GKYFESDAGNTADILNFY 504 KLP G + E+ AGN A + N Y Sbjct: 19 KLPFSGLFIENQAGN-APVFNNY 40 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,870 Number of Sequences: 336 Number of extensions: 3140 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17593745 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -