BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0300X.Seq (404 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11G7.06c |mug132||S. pombe specific UPF0300 family protein 3... 25 4.5 SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22... 25 5.9 SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha... 25 5.9 >SPAC11G7.06c |mug132||S. pombe specific UPF0300 family protein 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 430 Score = 25.0 bits (52), Expect = 4.5 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 207 YRLNINYWIVGLYSNYNAFDRDPAV 281 Y N +Y +G+ N+NAF+ D V Sbjct: 111 YHQNKSYLKMGVTDNFNAFEEDSRV 135 >SPCC1620.14c |snf22|SPCC830.01c|ATP-dependent DNA helicase Snf22|Schizosaccharomyces pombe|chr 3|||Manual Length = 1680 Score = 24.6 bits (51), Expect = 5.9 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +1 Query: 67 WRLQXAGEPFH*LIELLFLLVAKTLLIILYTNITHIKKDHFNMSN 201 WR E ++ LFL KTL+ T I I +D+ N Sbjct: 1183 WRAAGKFELLDRILPKLFLTGHKTLMFFQMTQIMTIMEDYLRSKN 1227 >SPAC56F8.06c |alg10||dolichyl-phosphate-glucose-glycolipid alpha-glucosyltransferase Alg10|Schizosaccharomyces pombe|chr 1|||Manual Length = 445 Score = 24.6 bits (51), Expect = 5.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 59 VLVGDCKXPESRFISLLNCFFSWWLKHS 142 +L D +S F S ++CFFS W + + Sbjct: 141 LLAYDFALRKSAFSSSVSCFFSLWFRQT 168 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,381,376 Number of Sequences: 5004 Number of extensions: 23493 Number of successful extensions: 50 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 138190552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -