BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0298X.Seq (504 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 27 0.072 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 27 0.072 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 27 0.072 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 27 0.072 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.7 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 4.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 6.3 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 27.5 bits (58), Expect = 0.072 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 23 FTMAKPIDLHNRXALGVGYASVGLQHSRSAVLHAQVPPQYRTVMPPHALLN 175 F+ A P++L ++ + A+ GL++ H +PP PP LN Sbjct: 406 FSYAFPVNLTIPVSISLLIAACGLRNGDPCFFHDTIPPYLFFESPPVVFLN 456 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 27.5 bits (58), Expect = 0.072 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 23 FTMAKPIDLHNRXALGVGYASVGLQHSRSAVLHAQVPPQYRTVMPPHALLN 175 F+ A P++L ++ + A+ GL++ H +PP PP LN Sbjct: 406 FSYAFPVNLTIPVSISLLIAACGLRNGDPCFFHDTIPPYLFFESPPVVFLN 456 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 27.5 bits (58), Expect = 0.072 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 23 FTMAKPIDLHNRXALGVGYASVGLQHSRSAVLHAQVPPQYRTVMPPHALLN 175 F+ A P++L ++ + A+ GL++ H +PP PP LN Sbjct: 406 FSYAFPVNLTIPVSISLLIAACGLRNGDPCFFHDTIPPYLFFESPPVVFLN 456 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 27.5 bits (58), Expect = 0.072 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = +2 Query: 23 FTMAKPIDLHNRXALGVGYASVGLQHSRSAVLHAQVPPQYRTVMPPHALLN 175 F+ A P++L ++ + A+ GL++ H +PP PP LN Sbjct: 406 FSYAFPVNLTIPVSISLLIAACGLRNGDPCFFHDTIPPYLFFESPPVVFLN 456 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 4.7 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 204 HRGHACTSSCNRRLSFLEEEISAV 275 HR SS NRR F+ I+ + Sbjct: 262 HRFSTMVSSANRRREFIRSAITFI 285 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 4.7 Identities = 10/36 (27%), Positives = 16/36 (44%) Frame = -1 Query: 252 GMIVCGCSLKCTRGPCACGTFPLEALLRSA*GGITV 145 G+++ + RG C G +PL +R G V Sbjct: 853 GIMIWSVDMDDFRGSCGSGKYPLINAMRQELEGYKV 888 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 21.0 bits (42), Expect = 6.3 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = -1 Query: 75 PTPNAXLLCRSIGFAIVN 22 P PN L C + F +V+ Sbjct: 167 PLPNVILACHMLSFLMVH 184 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,342 Number of Sequences: 336 Number of extensions: 2189 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11944578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -