BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0298X.Seq (504 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 24 0.78 U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive o... 23 1.4 AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin ... 23 1.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 2.4 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 9.6 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 24.2 bits (50), Expect = 0.78 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 42 LTYTIXGHWAWGTLVWD 92 L Y I G+W++GT++ D Sbjct: 99 LLYEISGNWSFGTIMCD 115 >U70841-1|AAC47455.1| 377|Apis mellifera ultraviolet sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 1.4 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +2 Query: 47 LHNRXALGVGYASVG----LQHSRSAVLHAQVPPQYRTVMPPH 163 LHN+ G A + + R L VPP+Y ++ PH Sbjct: 3 LHNKTLAGKALAFIAEEGYVPSMREKFLGWNVPPEYSDLVRPH 45 >AF004168-1|AAC13417.1| 377|Apis mellifera blue-sensitive opsin protein. Length = 377 Score = 23.4 bits (48), Expect = 1.4 Identities = 13/43 (30%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +2 Query: 47 LHNRXALGVGYASVG----LQHSRSAVLHAQVPPQYRTVMPPH 163 LHN+ G A + + R L VPP+Y ++ PH Sbjct: 3 LHNKTLAGKALAFIAEEGYVPSMREKFLGWNVPPEYSDLVHPH 45 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +3 Query: 318 IYTRIEKVKVLNVSG 362 I+TR+E++ VLN++G Sbjct: 304 IFTRLEQLLVLNLAG 318 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 20.6 bits (41), Expect = 9.6 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 137 QYRTVMPPHALLNSASSGN 193 Q + V+ PH + +AS+GN Sbjct: 168 QLKQVVMPHDIAVNASTGN 186 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,601 Number of Sequences: 438 Number of extensions: 3188 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13864083 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -