BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0294.Seq (848 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23H4.17c |srb10|prk1, cdk8|cyclin-dependent protein kinase S... 27 3.4 SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces p... 26 7.8 >SPAC23H4.17c |srb10|prk1, cdk8|cyclin-dependent protein kinase Srb10 |Schizosaccharomyces pombe|chr 1|||Manual Length = 352 Score = 27.1 bits (57), Expect = 3.4 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 631 QHANMVSLLQQLIQDAWQNAAFEGISMDCL 720 QH N+VSL+Q L++D + FE D L Sbjct: 69 QHENIVSLVQVLLKDGTISMVFEYAEHDLL 98 >SPAC56E4.04c |cut6||acetyl-CoA carboxylase|Schizosaccharomyces pombe|chr 1|||Manual Length = 2280 Score = 25.8 bits (54), Expect = 7.8 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +1 Query: 595 FAATKADHVTIDQHANMVSLLQQLIQDAWQNAAFEGISM 711 ++ + D V ID+ N+V++ + Q A +A EGI++ Sbjct: 213 WSGNELDQVRIDEETNIVTVDDDVYQKACIRSAEEGIAV 251 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,385,331 Number of Sequences: 5004 Number of extensions: 67453 Number of successful extensions: 173 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 168 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 173 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -