BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0294.Seq (848 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 36 0.042 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.055 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.13 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.22 SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) 33 0.29 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 33 0.39 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 32 0.51 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.51 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.68 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 31 0.89 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.89 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 31 1.2 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_50117| Best HMM Match : EB1 (HMM E-Value=3.6) 31 1.2 SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 31 1.2 SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 31 1.6 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) 31 1.6 SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_16314| Best HMM Match : DUF765 (HMM E-Value=3.5) 31 1.6 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 30 2.1 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 30 2.1 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_52737| Best HMM Match : B_lectin (HMM E-Value=7.6) 30 2.1 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) 30 2.1 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_35386| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_33267| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-10) 30 2.1 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 30 2.1 SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) 30 2.1 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 30 2.1 SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) 30 2.1 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 30 2.1 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) 30 2.1 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_2294| Best HMM Match : Extensin_2 (HMM E-Value=1.5) 30 2.1 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 30 2.1 SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 30 2.7 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 30 2.7 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 30 2.7 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 30 2.7 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_42354| Best HMM Match : GETHR (HMM E-Value=5.3) 30 2.7 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_35366| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_32058| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_26645| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 30 2.7 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 30 2.7 SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 SB_3518| Best HMM Match : Ank (HMM E-Value=0.15) 30 2.7 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_37059| Best HMM Match : PA (HMM E-Value=0.0015) 29 3.6 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_34011| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 29 3.6 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 29 3.6 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 29 3.6 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 29 3.6 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 3.6 SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_29496| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_25836| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_18514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 29 3.6 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) 29 3.6 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 29 4.8 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 29 4.8 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 29 4.8 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_12139| Best HMM Match : Autotransporter (HMM E-Value=1.4) 29 4.8 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) 29 4.8 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 29 4.8 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_43717| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_43349| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_43046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_42579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_41735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_41531| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_41271| Best HMM Match : EGF (HMM E-Value=1.2e-20) 29 4.8 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 29 4.8 SB_38869| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_36834| Best HMM Match : Rap_GAP (HMM E-Value=0.00045) 29 4.8 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_31130| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_30964| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_30748| Best HMM Match : RBM1CTR (HMM E-Value=2.1) 29 4.8 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_27866| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_23292| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_23253| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_22502| Best HMM Match : FtsL (HMM E-Value=0.0086) 29 4.8 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_20114| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_15685| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_13520| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 29 4.8 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 29 4.8 SB_11000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 29 4.8 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_9536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_6535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_5594| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_3601| Best HMM Match : DUF765 (HMM E-Value=3.9) 29 4.8 SB_3084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_2194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 29 4.8 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 29 6.3 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 29 6.3 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 29 6.3 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_55207| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 29 6.3 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 29 6.3 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 29 6.3 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 29 6.3 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 29 6.3 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 29 6.3 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 29 6.3 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 29 6.3 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 29 6.3 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 29 6.3 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 29 6.3 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 29 6.3 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 29 6.3 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 29 6.3 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.3 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 35.9 bits (79), Expect = 0.042 Identities = 16/29 (55%), Positives = 23/29 (79%) Frame = -3 Query: 93 ELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 ++++ L++KA +S SP DPLVLERPPP Sbjct: 107 DVTRALVSKAESNSCSPG-DPLVLERPPP 134 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.5 bits (78), Expect = 0.055 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = -3 Query: 93 ELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 ++S LI K A +S SP DPLVLERPPP Sbjct: 19 QISNILIPKIASNSCSPG-DPLVLERPPP 46 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -3 Query: 96 QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 Q L K +KA + + P DPLVLERPPP Sbjct: 14 QMLIKTANSKATRSNSCSPGDPLVLERPPP 43 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 33.9 bits (74), Expect = 0.17 Identities = 13/28 (46%), Positives = 21/28 (75%) Frame = -3 Query: 90 LSKPLIAKAAKDSLSPPTDPLVLERPPP 7 +++P +++ A+ + P DPLVLERPPP Sbjct: 82 INQPSMSQHARSNSCSPGDPLVLERPPP 109 >SB_44533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.5 bits (73), Expect = 0.22 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -3 Query: 93 ELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 EL+ LI + + P DPLVLERPPP Sbjct: 18 ELAPQLIRSLQRSNSCSPGDPLVLERPPP 46 >SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 33.5 bits (73), Expect = 0.22 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -3 Query: 87 SKPLIAKAAKDSLSPPTDPLVLERPPP 7 +KPL + +S SP DPLVLERPPP Sbjct: 161 TKPLTQEKGSNSCSPG-DPLVLERPPP 186 >SB_46226| Best HMM Match : Ion_trans (HMM E-Value=1.4013e-45) Length = 727 Score = 33.1 bits (72), Expect = 0.29 Identities = 17/29 (58%), Positives = 20/29 (68%) Frame = -3 Query: 93 ELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 E+ KP+ K +S SP DPLVLERPPP Sbjct: 38 EIKKPIF-KPTSNSCSPG-DPLVLERPPP 64 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 32.7 bits (71), Expect = 0.39 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = -3 Query: 81 PLIAKAAKDSLSPPTDPLVLERPPP 7 P++ A +S SP DPLVLERPPP Sbjct: 476 PILEAGASNSCSPG-DPLVLERPPP 499 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 32.3 bits (70), Expect = 0.51 Identities = 17/29 (58%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Frame = -3 Query: 90 LSKPLIAKAAKDSLS-PPTDPLVLERPPP 7 +S P I K S S P DPLVLERPPP Sbjct: 203 ISSPEICKTVNVSNSCSPGDPLVLERPPP 231 >SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/35 (51%), Positives = 22/35 (62%) Frame = -3 Query: 111 CPVK*QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 CP ++ KP A+ +S SP DPLVLERPPP Sbjct: 3 CPSVWEQRRKP--ARPRSNSCSPG-DPLVLERPPP 34 >SB_40640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 +DS P DPLVLERPPP Sbjct: 85 RDSYENPGDPLVLERPPP 102 >SB_18165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 32.3 bits (70), Expect = 0.51 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 93 ELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 E K + A+ + + P DPLVLERPPP Sbjct: 38 EYGKAIEAEEGQSNSCSPGDPLVLERPPP 66 >SB_2728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 32.3 bits (70), Expect = 0.51 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = -3 Query: 114 VCPVK*QELSKPLIAKAAKDSLS---PPTDPLVLERPPP 7 + PV ++ S P++ K LS P DPLVLERPPP Sbjct: 9 ITPVA-KDSSSPVLLKLVLQGLSNSCSPGDPLVLERPPP 46 >SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.68 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = -3 Query: 90 LSKPLIAKAAKDSLSPPTDPLVLERPPP 7 + +P I +A K + P DPLVLERPPP Sbjct: 13 IRRPTI-QARKSNSCSPGDPLVLERPPP 39 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A+AA + P DPLVLERPPP Sbjct: 42 AEAALSNSCSPGDPLVLERPPP 63 >SB_28661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.9 bits (69), Expect = 0.68 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -3 Query: 93 ELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 +L K LI +S SP DPLVLERPPP Sbjct: 1 DLFKSLIHNHKSNSCSPG-DPLVLERPPP 28 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.9 bits (69), Expect = 0.68 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -3 Query: 87 SKPLIAKAAKDSLSPPTDPLVLERPPP 7 S+P A +S SP DPLVLERPPP Sbjct: 15 SEPKRVNAVSNSCSPG-DPLVLERPPP 40 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.9 bits (69), Expect = 0.68 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -3 Query: 81 PLIAKAAKDSLSPPTDPLVLERPPP 7 P + AK + P DPLVLERPPP Sbjct: 21 PPRGRRAKSNSCSPGDPLVLERPPP 45 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 51 LSPPTDPLVLERPPP 7 LS P DPLVLERPPP Sbjct: 366 LSSPGDPLVLERPPP 380 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -3 Query: 51 LSPPTDPLVLERPPP 7 LS P DPLVLERPPP Sbjct: 431 LSSPGDPLVLERPPP 445 >SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) Length = 974 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 45 PPTDPLVLERPPP 7 PP DPLVLERPPP Sbjct: 855 PPGDPLVLERPPP 867 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 ++K+ + + P DPLVLERPPP Sbjct: 21 LSKSKRSNSCSPGDPLVLERPPP 43 >SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 31.5 bits (68), Expect = 0.89 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -3 Query: 105 VK*QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 VK E K ++ P DPLVLERPPP Sbjct: 112 VKISESEPETFVKISESEPETPGDPLVLERPPP 144 >SB_17133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 90 LSKPLIAKAAKDSLSPPTDPLVLERPPP 7 L + L+ + + P DPLVLERPPP Sbjct: 4 LRRSLVTDEIRSNSCSPGDPLVLERPPP 31 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.5 bits (68), Expect = 0.89 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = -3 Query: 96 QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 +E +I K +S SP DPLVLERPPP Sbjct: 17 REFVYTVIQKVVSNSCSPG-DPLVLERPPP 45 >SB_1971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.5 bits (68), Expect = 0.89 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 LI + + P DPLVLERPPP Sbjct: 6 LITRGVSSNSCSPGDPLVLERPPP 29 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 +K A +S SP DPLVLERPPP Sbjct: 20 SKRASNSCSPG-DPLVLERPPP 40 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 + A +A +S SP DPLVLERPPP Sbjct: 1 MFALSASNSCSPG-DPLVLERPPP 23 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 KA +S SP DPLVLERPPP Sbjct: 14 KAGSNSCSPG-DPLVLERPPP 33 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 +A+ +S SP DPLVLERPPP Sbjct: 3471 VARVVSNSCSPG-DPLVLERPPP 3492 >SB_50117| Best HMM Match : EB1 (HMM E-Value=3.6) Length = 362 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -3 Query: 87 SKPLIAKAAKDSLSPPTDPLVLERPPP 7 S L K + L P DPLVLERPPP Sbjct: 50 SSRLKTKGVQSLLLCPGDPLVLERPPP 76 >SB_48897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 5/30 (16%) Frame = -3 Query: 81 PLIAKAAKDSLSP-----PTDPLVLERPPP 7 PL++ LSP P DPLVLERPPP Sbjct: 43 PLLSPCTPPHLSPSNSCSPGDPLVLERPPP 72 >SB_47151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.1 bits (67), Expect = 1.2 Identities = 17/30 (56%), Positives = 22/30 (73%) Frame = -3 Query: 96 QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 Q+ +P I +A+ +S SP DPLVLERPPP Sbjct: 4 QQSDRPHIHRAS-NSCSPG-DPLVLERPPP 31 >SB_36003| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 +AA +S SP DPLVLERPPP Sbjct: 24 QAASNSCSPG-DPLVLERPPP 43 >SB_21711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L+A +S SP DPLVLERPPP Sbjct: 40 LVANKPSNSCSPG-DPLVLERPPP 62 >SB_19132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.1 bits (67), Expect = 1.2 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 AK + P DPLVLERPPP Sbjct: 17 AKSNSCSPGDPLVLERPPP 35 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L +A +S SP DPLVLERPPP Sbjct: 3 LFCEAVSNSCSPG-DPLVLERPPP 25 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 IA A + P DPLVLERPPP Sbjct: 13 IANAKVSNSCSPGDPLVLERPPP 35 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 +A A +S SP DPLVLERPPP Sbjct: 189 VAVAVSNSCSPG-DPLVLERPPP 210 >SB_7708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 +K A +S SP DPLVLERPPP Sbjct: 2 SKRASNSCSPG-DPLVLERPPP 22 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/34 (47%), Positives = 21/34 (61%) Frame = -3 Query: 108 PVK*QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 P Q S+ +++ +S SP DPLVLERPPP Sbjct: 66 PPSSQVFSQSPLSRFTSNSCSPG-DPLVLERPPP 98 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L K + + P DPLVLERPPP Sbjct: 6 LYVKLERSNSCSPGDPLVLERPPP 29 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 +++A +S SP DPLVLERPPP Sbjct: 50 SRSASNSCSPG-DPLVLERPPP 70 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 I K +S SP DPLVLERPPP Sbjct: 9 ITKVLSNSCSPG-DPLVLERPPP 30 >SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) Length = 460 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = -3 Query: 90 LSKPLIAKAAKDSLSPPTDPLVLERPPP 7 +++ + A A + P DPLVLERPPP Sbjct: 326 VTRSVTATLASADVRRPGDPLVLERPPP 353 >SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -3 Query: 87 SKPLIAKAAKDSLSPPTDPLVLERPPP 7 S L K S + P DPLVLERPPP Sbjct: 280 SMKLDKKVQYTSAAHPGDPLVLERPPP 306 >SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 +A + K P DPLVLERPPP Sbjct: 19 LASSRKSPPRSPGDPLVLERPPP 41 >SB_44658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = -3 Query: 87 SKPLIAKAAKDSLSPPTDPLVLERPPP 7 S+ I + A + P DPLVLERPPP Sbjct: 4 SRVSIKQQATSNSCSPGDPLVLERPPP 30 >SB_41224| Best HMM Match : DUF765 (HMM E-Value=3.5) Length = 126 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 AA +S SP DPLVLERPPP Sbjct: 2 AASNSCSPG-DPLVLERPPP 20 >SB_34798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K A +S SP DPLVLERPPP Sbjct: 11 KKASNSCSPG-DPLVLERPPP 30 >SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/21 (71%), Positives = 17/21 (80%), Gaps = 1/21 (4%) Frame = -3 Query: 66 AAKDSLS-PPTDPLVLERPPP 7 +AK+S S P DPLVLERPPP Sbjct: 25 SAKESNSCSPGDPLVLERPPP 45 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 AA +S SP DPLVLERPPP Sbjct: 23 AASNSCSPG-DPLVLERPPP 41 >SB_16314| Best HMM Match : DUF765 (HMM E-Value=3.5) Length = 127 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 AA +S SP DPLVLERPPP Sbjct: 2 AASNSCSPG-DPLVLERPPP 20 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 AA +S SP DPLVLERPPP Sbjct: 20 AASNSCSPG-DPLVLERPPP 38 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 KA +S SP DPLVLERPPP Sbjct: 31 KALSNSCSPG-DPLVLERPPP 50 >SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K A +S SP DPLVLERPPP Sbjct: 4 KKASNSCSPG-DPLVLERPPP 23 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A A +S SP DPLVLERPPP Sbjct: 11 ANIASNSCSPG-DPLVLERPPP 31 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 30.3 bits (65), Expect = 2.1 Identities = 17/31 (54%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 96 QELSKPLIAKAAKDSLS-PPTDPLVLERPPP 7 + L K L K S S P DPLVLERPPP Sbjct: 50 ERLDKKLRNKHTNPSNSCSPGDPLVLERPPP 80 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 54 SLSPPTDPLVLERPPP 7 +L P DPLVLERPPP Sbjct: 44 NLKSPGDPLVLERPPP 59 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 + A + + P DPLVLERPPP Sbjct: 9 SNAVRSNSCSPGDPLVLERPPP 30 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 AK +S SP DPLVLERPPP Sbjct: 59 AKKLSNSCSPG-DPLVLERPPP 79 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K A +S SP DPLVLERPPP Sbjct: 40 KNASNSCSPG-DPLVLERPPP 59 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 I++ +S P DPLVLERPPP Sbjct: 4 ISRENGNSRKSPGDPLVLERPPP 26 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/25 (56%), Positives = 15/25 (60%) Frame = -3 Query: 81 PLIAKAAKDSLSPPTDPLVLERPPP 7 PLI + P DPLVLERPPP Sbjct: 3 PLIQIRGISNSCSPGDPLVLERPPP 27 >SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 + K D P DPLVLERPPP Sbjct: 18 LIKRTCDPWQSPGDPLVLERPPP 40 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/21 (71%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K A +S SP DPLVLERPPP Sbjct: 30 KNASNSCSPG-DPLVLERPPP 49 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 ++ K +S SP DPLVLERPPP Sbjct: 14 ILIKITSNSCSPG-DPLVLERPPP 36 >SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 84 KPLIAKAAKDSLSPPTDPLVLERPPP 7 +P + + P DPLVLERPPP Sbjct: 2 RPCVTMPRASNSCSPGDPLVLERPPP 27 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K+ + + P DPLVLERPPP Sbjct: 5 KSRRSNSCSPGDPLVLERPPP 25 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = -3 Query: 114 VCPVK*QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 +C V+ Q K + K +S SP DPLVLERPPP Sbjct: 13 ICRVRTQIAEKHV--KFTSNSCSPG-DPLVLERPPP 45 >SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 AA + P DPLVLERPPP Sbjct: 2 AATSNSCSPGDPLVLERPPP 21 >SB_52737| Best HMM Match : B_lectin (HMM E-Value=7.6) Length = 187 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 54 SLSPPTDPLVLERPPP 7 +L+ P DPLVLERPPP Sbjct: 66 ALANPGDPLVLERPPP 81 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = -3 Query: 90 LSKPLIAKAAKDSLSPPTDPLVLERPPP 7 +S +I+ A + P DPLVLERPPP Sbjct: 9 ISANIISIAFVSNSCSPGDPLVLERPPP 36 >SB_44611| Best HMM Match : DUF765 (HMM E-Value=2.6) Length = 159 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/24 (66%), Positives = 17/24 (70%), Gaps = 1/24 (4%) Frame = -3 Query: 75 IAKAAKDSLS-PPTDPLVLERPPP 7 I+ A K S S P DPLVLERPPP Sbjct: 29 ISLATKTSNSCSPGDPLVLERPPP 52 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 93 ELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 + S PL + P DPLVLERPPP Sbjct: 30 QTSSPLQPSENVSNSCSPGDPLVLERPPP 58 >SB_35386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = -3 Query: 105 VK*QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 VK + I A + S P DPLVLERPPP Sbjct: 7 VKNDNFCRNFIDMALEASDYSPGDPLVLERPPP 39 >SB_33516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L+ A +S SP DPLVLERPPP Sbjct: 40 LVDPARSNSCSPG-DPLVLERPPP 62 >SB_33267| Best HMM Match : F5_F8_type_C (HMM E-Value=3.4e-10) Length = 1292 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 51 LSPPTDPLVLERPPP 7 L+ P DPLVLERPPP Sbjct: 1172 LTSPGDPLVLERPPP 1186 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/36 (50%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -3 Query: 105 VK*QELSKPLIAKAAKDSLS---PPTDPLVLERPPP 7 +K E +K L K + S S P DPLVLERPPP Sbjct: 339 IKFDENAKTLEEKTNEASASNSCSPGDPLVLERPPP 374 >SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) Length = 200 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 I K ++ P DPLVLERPPP Sbjct: 72 IRDTCKYGVTRPGDPLVLERPPP 94 >SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 IA+ + P DPLVLERPPP Sbjct: 6 IARVDASNSCSPGDPLVLERPPP 28 >SB_23716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 + A +A +S SP DPLVLERPPP Sbjct: 1 MAAISASNSCSPG-DPLVLERPPP 23 >SB_22515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 LI+ + + P DPLVLERPPP Sbjct: 8 LISANIRSNSCSPGDPLVLERPPP 31 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K ++ + P DPLVLERPPP Sbjct: 4 KKSRSNSCSPGDPLVLERPPP 24 >SB_20823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 + A+ + P DPLVLERPPP Sbjct: 3 VVSFARSNSCSPGDPLVLERPPP 25 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/25 (60%), Positives = 16/25 (64%) Frame = -3 Query: 81 PLIAKAAKDSLSPPTDPLVLERPPP 7 P A +S SP DPLVLERPPP Sbjct: 6 PYFIMLASNSCSPG-DPLVLERPPP 29 >SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) Length = 138 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/23 (65%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -3 Query: 72 AKAAKDSLS-PPTDPLVLERPPP 7 ++A K S S P DPLVLERPPP Sbjct: 9 SRATKTSNSCSPGDPLVLERPPP 31 >SB_16436| Best HMM Match : DUF765 (HMM E-Value=9.2) Length = 129 Score = 30.3 bits (65), Expect = 2.1 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 + A+ +S SP DPLVLERPPP Sbjct: 1 MFARPTSNSCSPG-DPLVLERPPP 23 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/24 (54%), Positives = 19/24 (79%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 ++++ + +S SP DPLVLERPPP Sbjct: 14 VLSRVSSNSCSPG-DPLVLERPPP 36 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 54 SLSPPTDPLVLERPPP 7 +L+ P DPLVLERPPP Sbjct: 660 TLNHPGDPLVLERPPP 675 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 42 PTDPLVLERPPP 7 P DPLVLERPPP Sbjct: 521 PGDPLVLERPPP 532 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K + + P DPLVLERPPP Sbjct: 16 KCCRSNSCSPGDPLVLERPPP 36 >SB_9010| Best HMM Match : RVP (HMM E-Value=0.14) Length = 711 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 ++++L P DPLVLERPPP Sbjct: 174 SQEALLCPGDPLVLERPPP 192 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 AK +S SP DPLVLERPPP Sbjct: 27 AKEISNSCSPG-DPLVLERPPP 47 >SB_2294| Best HMM Match : Extensin_2 (HMM E-Value=1.5) Length = 310 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/17 (76%), Positives = 13/17 (76%) Frame = -3 Query: 57 DSLSPPTDPLVLERPPP 7 D S P DPLVLERPPP Sbjct: 188 DINSSPGDPLVLERPPP 204 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 I +A + P DPLVLERPPP Sbjct: 92 IKRALASNSCSPGDPLVLERPPP 114 >SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 30.3 bits (65), Expect = 2.1 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L K +S SP DPLVLERPPP Sbjct: 14 LFKKGPSNSCSPG-DPLVLERPPP 36 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 IA + + P DPLVLERPPP Sbjct: 8 IANSHTSNSCSPGDPLVLERPPP 30 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/28 (50%), Positives = 19/28 (67%) Frame = -3 Query: 90 LSKPLIAKAAKDSLSPPTDPLVLERPPP 7 +S +++ +S SP DPLVLERPPP Sbjct: 9 ISANIVSHNTSNSCSPG-DPLVLERPPP 35 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 + A +S SP DPLVLERPPP Sbjct: 51 RVASNSCSPG-DPLVLERPPP 70 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 +K S + P DPLVLERPPP Sbjct: 59 SKLSSTGPGDPLVLERPPP 77 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K++ + P DPLVLERPPP Sbjct: 16 KSSTSNSCSPGDPLVLERPPP 36 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -3 Query: 51 LSPPTDPLVLERPPP 7 L P DPLVLERPPP Sbjct: 46 LESPGDPLVLERPPP 60 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A+ + P DPLVLERPPP Sbjct: 3 ARSNSCSPGDPLVLERPPP 21 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A++ +S SP DPLVLERPPP Sbjct: 7 AESTSNSCSPG-DPLVLERPPP 27 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 96 QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 Q+ K ++ + + P DPLVLERPPP Sbjct: 81 QDEKKHVVIEWVLSNSCSPGDPLVLERPPP 110 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 ++ A +S SP DPLVLERPPP Sbjct: 17 SQTASNSCSPG-DPLVLERPPP 37 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 A++ + P DPLVLERPPP Sbjct: 21 ASQSNSCSPGDPLVLERPPP 40 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 4/34 (11%) Frame = -3 Query: 96 QELSKPLIAKAAKDSLSP----PTDPLVLERPPP 7 + L + A D+LS P DPLVLERPPP Sbjct: 8 RHLGRHFTGHAKNDALSSNSCSPGDPLVLERPPP 41 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 I A +S SP DPLVLERPPP Sbjct: 10 INSTASNSCSPG-DPLVLERPPP 31 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 +I A +S SP DPLVLERPPP Sbjct: 75 IIIWAGSNSCSPG-DPLVLERPPP 97 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/25 (60%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 78 LIAKAAKDSLS-PPTDPLVLERPPP 7 ++ AA S S P DPLVLERPPP Sbjct: 53 ILENAANGSNSCSPGDPLVLERPPP 77 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 42 PTDPLVLERPPPP 4 P +PLVLERPPPP Sbjct: 23 PGEPLVLERPPPP 35 >SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A+ + P DPLVLERPPP Sbjct: 62 ARSNSCSPGDPLVLERPPP 80 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A A +S SP DPLVLERPPP Sbjct: 32 ATAQSNSCSPG-DPLVLERPPP 52 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -3 Query: 81 PLIAKAAKDSLSPPTDPLVLERPPP 7 P K+ +S SP DPLVLERPPP Sbjct: 6 PKHKKSLSNSCSPG-DPLVLERPPP 29 >SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 +IA +S SP DPLVLERPPP Sbjct: 20 IIAVRRSNSCSPG-DPLVLERPPP 42 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/27 (55%), Positives = 18/27 (66%) Frame = -3 Query: 87 SKPLIAKAAKDSLSPPTDPLVLERPPP 7 S+ L + +S SP DPLVLERPPP Sbjct: 30 SRQLSITSTSNSCSPG-DPLVLERPPP 55 >SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 +A +S SP DPLVLERPPP Sbjct: 8 VADGGSNSCSPG-DPLVLERPPP 29 >SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K + + P DPLVLERPPP Sbjct: 7 KRTRSNSCSPGDPLVLERPPP 27 >SB_42354| Best HMM Match : GETHR (HMM E-Value=5.3) Length = 162 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 + S + P DPLVLERPPP Sbjct: 38 RHSTTRPGDPLVLERPPP 55 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.9 bits (64), Expect = 2.7 Identities = 16/26 (61%), Positives = 17/26 (65%) Frame = -3 Query: 84 KPLIAKAAKDSLSPPTDPLVLERPPP 7 KP K +S SP DPLVLERPPP Sbjct: 24 KPEGNKDVSNSCSPG-DPLVLERPPP 48 >SB_39848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = -3 Query: 81 PLIAKAAKDSLSPPTDPLVLERPPP 7 PL+ +S SP DPLVLERPPP Sbjct: 8 PLMFTDPSNSCSPG-DPLVLERPPP 31 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -3 Query: 93 ELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 E+ LI + P DPLVLERPPP Sbjct: 9 EMPYGLIVLTVVSNSCSPGDPLVLERPPP 37 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 LI+ + + P DPLVLERPPP Sbjct: 8 LISANIQSNSCSPGDPLVLERPPP 31 >SB_37222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 + K + + P DPLVLERPPP Sbjct: 31 LRKLCESNSCSPGDPLVLERPPP 53 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 + K + +S SP DPLVLERPPP Sbjct: 2 LKKRSSNSCSPG-DPLVLERPPP 23 >SB_35366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 57 DSLSPPTDPLVLERPPP 7 + L P DPLVLERPPP Sbjct: 25 EELRGPGDPLVLERPPP 41 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 KA + P DPLVLERPPP Sbjct: 3 KAEVSNSCSPGDPLVLERPPP 23 >SB_32058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K++ P DPLVLERPPP Sbjct: 46 KEAERSPGDPLVLERPPP 63 >SB_31868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K S P DPLVLERPPP Sbjct: 21 KASQHSPGDPLVLERPPP 38 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/22 (68%), Positives = 16/22 (72%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A A +S SP DPLVLERPPP Sbjct: 18 APLASNSCSPG-DPLVLERPPP 38 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 ++ K + P DPLVLERPPP Sbjct: 24 IVTKFGVSNSCSPGDPLVLERPPP 47 >SB_26645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 AK L+ P DPLVLERPPP Sbjct: 19 AKRLWRRLACPGDPLVLERPPP 40 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 2.7 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K A + P DPLVLERPPP Sbjct: 29 KIAVSNSCSPGDPLVLERPPP 49 >SB_24360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 +K + P DPLVLERPPP Sbjct: 3 SKSNSCSPGDPLVLERPPP 21 >SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 134 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 +A+ +S SP DPLVLERPPP Sbjct: 6 LAQITSNSCSPG-DPLVLERPPP 27 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 + A+ +S SP DPLVLERPPP Sbjct: 11 LVTASSNSCSPG-DPLVLERPPP 32 >SB_10667| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.9 bits (64), Expect = 2.7 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 I + +S SP DPLVLERPPP Sbjct: 60 ITRGGSNSCSPG-DPLVLERPPP 81 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.9 bits (64), Expect = 2.7 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L +A +S SP DPLVLERPPP Sbjct: 28 LTIHSASNSCSPG-DPLVLERPPP 50 >SB_3518| Best HMM Match : Ank (HMM E-Value=0.15) Length = 159 Score = 29.9 bits (64), Expect = 2.7 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 48 SPPTDPLVLERPPP 7 S P DPLVLERPPP Sbjct: 40 SSPGDPLVLERPPP 53 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 11 KSNSCSPGDPLVLERPPP 28 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = -3 Query: 90 LSKPLIAKAAKDSLSPPTDPLVLERPPP 7 LS P K + + P DPLVLERPPP Sbjct: 13 LSNP--PKNLRSNSCSPGDPLVLERPPP 38 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 + ++ + + P DPLVLERPPP Sbjct: 107 LKRSVESNSCSPGDPLVLERPPP 129 >SB_37059| Best HMM Match : PA (HMM E-Value=0.0015) Length = 610 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +3 Query: 405 GSIRIIFCALTARLCWWIACNLSTVGHRHLMICVCTDAADAKFS 536 G + +F L AR W N T HR L I D+ +KF+ Sbjct: 220 GDVLNVFRRLDARYSWLPTVNTLTAKHRRLRILNINDSCASKFA 263 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K+ + P DPLVLERPPP Sbjct: 3 KSGASNSCSPGDPLVLERPPP 23 >SB_34011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = +3 Query: 405 GSIRIIFCALTARLCWWIACNLSTVGHRHLMICVCTDAADAKFS 536 G + +F L AR W N T HR L I D+ +KF+ Sbjct: 37 GDVLNVFRRLDARYSWLPTVNTLTAKHRRLRILNINDSCASKFA 80 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L+ ++ +S SP DPLVLERPPP Sbjct: 198 LMYSSSSNSCSPG-DPLVLERPPP 220 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/24 (62%), Positives = 16/24 (66%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 LI +S SP DPLVLERPPP Sbjct: 11 LIRPVLSNSCSPG-DPLVLERPPP 33 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 4/34 (11%) Frame = -3 Query: 96 QELSKPLI-AKAAKDSLS---PPTDPLVLERPPP 7 + L + L+ AK K+ +S P DPLVLERPPP Sbjct: 104 RSLCRQLVRAKNQKEIISNSCSPGDPLVLERPPP 137 >SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) Length = 340 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K AK ++ P DPLVLERPPP Sbjct: 214 KIAK-KVANPGDPLVLERPPP 233 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/25 (64%), Positives = 20/25 (80%) Frame = -3 Query: 81 PLIAKAAKDSLSPPTDPLVLERPPP 7 PL +K++ +S SP DPLVLERPPP Sbjct: 2 PLPSKSS-NSCSPG-DPLVLERPPP 24 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K + + P DPLVLERPPP Sbjct: 39 KRSSSNSCSPGDPLVLERPPP 59 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 + K +S SP DPLVLERPPP Sbjct: 237 LKKKTSNSCSPG-DPLVLERPPP 258 >SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 261 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = -3 Query: 87 SKPLIAKAAKDSLSPPTDPLVLERPPP 7 SK LI ++S P DPLVLERPPP Sbjct: 131 SKRLIKLTYRNS---PGDPLVLERPPP 154 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 +A +S SP DPLVLERPPP Sbjct: 6 QATSNSCSPG-DPLVLERPPP 25 >SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K + +S SP DPLVLERPPP Sbjct: 3 KKSSNSCSPG-DPLVLERPPP 22 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 71 KSNSCSPGDPLVLERPPP 88 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K +S SP DPLVLERPPP Sbjct: 68 KGGSNSCSPG-DPLVLERPPP 87 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K + +S SP DPLVLERPPP Sbjct: 33 KLSSNSCSPG-DPLVLERPPP 52 >SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K +S SP DPLVLERPPP Sbjct: 3 KGGSNSCSPG-DPLVLERPPP 22 >SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 +A +S SP DPLVLERPPP Sbjct: 11 SASNSCSPG-DPLVLERPPP 29 >SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 ++ + + P DPLVLERPPP Sbjct: 27 SRGGRSNSCSPGDPLVLERPPP 48 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 188 KSNSCSPGDPLVLERPPP 205 >SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 21 KSNSCSPGDPLVLERPPP 38 >SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 +A +S SP DPLVLERPPP Sbjct: 2 QAGSNSCSPG-DPLVLERPPP 21 >SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L A + P DPLVLERPPP Sbjct: 52 LFALKVAHATKSPGDPLVLERPPP 75 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 +I + +S SP DPLVLERPPP Sbjct: 21 VIMRITSNSCSPG-DPLVLERPPP 43 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 20 KSNSCSPGDPLVLERPPP 37 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 A+ + P DPLVLERPPP Sbjct: 4 ASSSNSCSPGDPLVLERPPP 23 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K + +S SP DPLVLERPPP Sbjct: 65 KLSSNSCSPG-DPLVLERPPP 84 >SB_46138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1106 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -3 Query: 51 LSPPTDPLVLERPPP 7 ++ P DPLVLERPPP Sbjct: 321 IASPGDPLVLERPPP 335 >SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K +S SP DPLVLERPPP Sbjct: 5 KGGSNSCSPG-DPLVLERPPP 24 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 +A +S SP DPLVLERPPP Sbjct: 54 RALSNSCSPG-DPLVLERPPP 73 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 +A+ +S SP DPLVLERPPP Sbjct: 2 VAQHISNSCSPG-DPLVLERPPP 23 >SB_43468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/30 (60%), Positives = 20/30 (66%) Frame = -3 Query: 96 QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 QEL + L A +S SP DPLVLERPPP Sbjct: 11 QELGEYL---TASNSCSPG-DPLVLERPPP 36 >SB_43000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 14 KSNSCSPGDPLVLERPPP 31 >SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 175 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 A+ +S SP DPLVLERPPP Sbjct: 50 ASSNSCSPG-DPLVLERPPP 68 >SB_37747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 5 KSNSCSPGDPLVLERPPP 22 >SB_36996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 3 KSNSCSPGDPLVLERPPP 20 >SB_36119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -3 Query: 81 PLIAKAAKDSLSPPTDPLVLERPPP 7 P++ K + +S SP DPLVLERPPP Sbjct: 19 PIVEKRS-NSCSPG-DPLVLERPPP 41 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 I + +S SP DPLVLERPPP Sbjct: 13 IGEVGSNSCSPG-DPLVLERPPP 34 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = -3 Query: 87 SKPLIAKAAKDSLSPPTDPLVLERPPP 7 S P + + + P DPLVLERPPP Sbjct: 5 SHPSASFLSSSNSCSPGDPLVLERPPP 31 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A + + P DPLVLERPPP Sbjct: 318 ANRVRSNSCSPGDPLVLERPPP 339 >SB_32594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 3 KSNSCSPGDPLVLERPPP 20 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 A + + P DPLVLERPPP Sbjct: 70 ATESNSCSPGDPLVLERPPP 89 >SB_29704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K + +S SP DPLVLERPPP Sbjct: 20 KQSSNSCSPG-DPLVLERPPP 39 >SB_29496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K +S SP DPLVLERPPP Sbjct: 1 KTTSNSCSPG-DPLVLERPPP 20 >SB_27248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 +++ A + P DPLVLERPPP Sbjct: 22 LSRYAGSNSCSPGDPLVLERPPP 44 >SB_25836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 48 SPPTDPLVLERPPP 7 SP DPLVLERPPP Sbjct: 29 SPGGDPLVLERPPP 42 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A+ +S SP DPLVLERPPP Sbjct: 24 ARLVSNSCSPG-DPLVLERPPP 44 >SB_24720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A+ + + P DPLVLERPPP Sbjct: 3 ARNERSNSCSPGDPLVLERPPP 24 >SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 + + A +S SP DPLVLERPPP Sbjct: 5 MFKRFASNSCSPG-DPLVLERPPP 27 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 + A +S SP DPLVLERPPP Sbjct: 17 RRASNSCSPG-DPLVLERPPP 36 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = -3 Query: 90 LSKPLIAKAAKDSLSPPTDPLVLERPPP 7 L K L + + P DPLVLERPPP Sbjct: 39 LKKILPGEKKTSNSCSPGDPLVLERPPP 66 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 29.5 bits (63), Expect = 3.6 Identities = 18/49 (36%), Positives = 25/49 (51%) Frame = -3 Query: 153 PRIVQRSIFSKEFVCPVK*QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 PR+V S+ + + S I K +++ P DPLVLERPPP Sbjct: 61 PRMVNISVVHTKVMKSTNGSTDSPDTIPK--NNAVPGPGDPLVLERPPP 107 >SB_18514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 90 LSKPLIAKAAKDSLSPPTDPLVLERPPP 7 ++ P A + P DPLVLERPPP Sbjct: 1 MNSPSCAGTHGSNSCSPGDPLVLERPPP 28 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 29.5 bits (63), Expect = 3.6 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = -3 Query: 93 ELSKPLIAKAAKDSLS-PPTDPLVLERPPP 7 EL+ + A S S P DPLVLERPPP Sbjct: 85 ELAADALGDAQPPSNSCSPGDPLVLERPPP 114 >SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/23 (65%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -3 Query: 72 AKAAKDSLS-PPTDPLVLERPPP 7 ++A K S S P DPLVLERPPP Sbjct: 38 SRANKGSNSCSPGDPLVLERPPP 60 >SB_9177| Best HMM Match : PPI_Ypi1 (HMM E-Value=1.9) Length = 121 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -3 Query: 84 KPLIAKAAKDSLSPPTDPLVLERPPP 7 +P A + P DPLVLERPPP Sbjct: 87 EPPSATGISSNSCSPGDPLVLERPPP 112 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 29.5 bits (63), Expect = 3.6 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 +I K + P DPLVLERPPP Sbjct: 62 IIQKIKISNSCSPGDPLVLERPPP 85 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/23 (65%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 IA +S SP DPLVLERPPP Sbjct: 13 IADFVSNSCSPG-DPLVLERPPP 34 >SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K +S SP DPLVLERPPP Sbjct: 36 KCTSNSCSPG-DPLVLERPPP 55 >SB_1937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/24 (62%), Positives = 15/24 (62%), Gaps = 2/24 (8%) Frame = -3 Query: 72 AKAAKDSLSP--PTDPLVLERPPP 7 AK A P P DPLVLERPPP Sbjct: 38 AKFASSFYGPFSPGDPLVLERPPP 61 >SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.5 bits (63), Expect = 3.6 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L+ + +S SP DPLVLERPPP Sbjct: 5 LVIRYISNSCSPG-DPLVLERPPP 27 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.5 bits (63), Expect = 3.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -3 Query: 60 KDSLSPPTDPLVLERPPP 7 K + P DPLVLERPPP Sbjct: 6 KSNSCSPGDPLVLERPPP 23 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 +A + + P DPLVLERPPP Sbjct: 7 LAPKKRRAWKSPGDPLVLERPPP 29 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 +I + + P DPLVLERPPP Sbjct: 301 IINRRVHKGCTGPGDPLVLERPPP 324 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 6 ASNSCSPG-DPLVLERPPP 23 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 30 ASNSCSPG-DPLVLERPPP 47 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 2 ASNSCSPG-DPLVLERPPP 19 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 LI+ +S SP DPLVLERPPP Sbjct: 13 LISFLISNSCSPG-DPLVLERPPP 35 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 34 ASNSCSPG-DPLVLERPPP 51 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 3 ASNSCSPG-DPLVLERPPP 20 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 81 PLIAKAAKDSLSPPTDPLVLERPPP 7 P + + + P DPLVLERPPP Sbjct: 868 PETSTVKRSNSCSPGDPLVLERPPP 892 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 10 ASNSCSPG-DPLVLERPPP 27 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 19 ASNSCSPG-DPLVLERPPP 36 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 38 ASNSCSPG-DPLVLERPPP 55 >SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A + + P DPLVLERPPP Sbjct: 28 ASGTQCKVPSPGDPLVLERPPP 49 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 LI + P DPLVLERPPP Sbjct: 5 LIVLTVGSNSCSPGDPLVLERPPP 28 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -3 Query: 78 LIAKAAKDSLS-PPTDPLVLERPPP 7 ++ + ++S S P DPLVLERPPP Sbjct: 15 IVGQRRRESNSCSPGDPLVLERPPP 39 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 A + P DPLVLERPPP Sbjct: 189 ACSSNSCSPGDPLVLERPPP 208 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 + ++ +S SP DPLVLERPPP Sbjct: 25 LCRSRSNSCSPG-DPLVLERPPP 46 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 83 ASNSCSPG-DPLVLERPPP 100 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 + + + + P DPLVLERPPP Sbjct: 61 LQRQGRSNSCSPGDPLVLERPPP 83 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K +S SP DPLVLERPPP Sbjct: 1064 KEVSNSCSPG-DPLVLERPPP 1083 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L A+ + P DPLVLERPPP Sbjct: 128 LRARIVGSNSCSPGDPLVLERPPP 151 >SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 3/32 (9%) Frame = -3 Query: 93 ELSKPL---IAKAAKDSLSPPTDPLVLERPPP 7 EL K L I + + + P DPLVLERPPP Sbjct: 63 ELQKRLKWEIKRYRESNSCSPGDPLVLERPPP 94 >SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K +S SP DPLVLERPPP Sbjct: 2 KIGSNSCSPG-DPLVLERPPP 21 >SB_12139| Best HMM Match : Autotransporter (HMM E-Value=1.4) Length = 751 Score = 29.1 bits (62), Expect = 4.8 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -3 Query: 576 RRKQTPEQGTLPVVKTLHQLRQCRRISLNACGPLLRGCRQS 454 RR + P G PV L QLR RR P RGCR S Sbjct: 321 RRARLPRTGAAPVPFRL-QLRIARRAKRVTTPPSRRGCRHS 360 >SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -3 Query: 84 KPLIAKAAKDSLSPPTDPLVLERPPP 7 K + + + P DPLVLERPPP Sbjct: 94 KNAVTRIRTSNSCSPGDPLVLERPPP 119 >SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 25 ASNSCSPG-DPLVLERPPP 42 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 79 ATSNSCSPG-DPLVLERPPP 97 >SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 ++ + + P DPLVLERPPP Sbjct: 11 SRTLRSNSCSPGDPLVLERPPP 32 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 6 ASNSCSPG-DPLVLERPPP 23 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 L K+ P DPLVLERPPP Sbjct: 9 LFVSENKELRLAPGDPLVLERPPP 32 >SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A ++ +S SP DPLVLERPPP Sbjct: 11 AVSSSNSCSPG-DPLVLERPPP 31 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 14 ASNSCSPG-DPLVLERPPP 31 >SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) Length = 638 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 54 SLSPPTDPLVLERPPP 7 ++ P DPLVLERPPP Sbjct: 24 TIRSPGDPLVLERPPP 39 >SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 6 ASNSCSPG-DPLVLERPPP 23 >SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) Length = 147 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 75 IAKAAKDSLSPPTDPLVLERPPP 7 +A +S SP DPLVLERPPP Sbjct: 19 LALTTSNSCSPG-DPLVLERPPP 40 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 20 ASNSCSPG-DPLVLERPPP 37 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 1193 ASNSCSPG-DPLVLERPPP 1210 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 52 ASNSCSPG-DPLVLERPPP 69 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/19 (73%), Positives = 15/19 (78%) Frame = -3 Query: 63 AKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 7 ASNSCSPG-DPLVLERPPP 24 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 + ++ + P DPLVLERPPP Sbjct: 61 RLSRSNSCSPGDPLVLERPPP 81 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.1 bits (62), Expect = 4.8 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -3 Query: 78 LIAKAAKDSLSPPTDPLVLERPPP 7 LI+ + P DPLVLERPPP Sbjct: 8 LISANITSNSCSPGDPLVLERPPP 31 >SB_47610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K +S SP DPLVLERPPP Sbjct: 3 KKGSNSCSPG-DPLVLERPPP 22 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -3 Query: 66 AAKDSLSPPTDPLVLERPPP 7 A +S SP DPLVLERPPP Sbjct: 10 AVSNSCSPG-DPLVLERPPP 28 >SB_47127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -3 Query: 72 AKAAKDSLSPPTDPLVLERPPP 7 A + + P DPLVLERPPP Sbjct: 11 ANIVESNSCSPGDPLVLERPPP 32 >SB_46157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 4.8 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -3 Query: 69 KAAKDSLSPPTDPLVLERPPP 7 K +S SP DPLVLERPPP Sbjct: 2 KKGSNSCSPG-DPLVLERPPP 21 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,332,016 Number of Sequences: 59808 Number of extensions: 540471 Number of successful extensions: 2653 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2653 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2407378809 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -