BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0294.Seq (848 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061259-1|AAL28807.1| 124|Drosophila melanogaster LD19086p pro... 30 3.5 BT010115-1|AAQ22584.1| 1664|Drosophila melanogaster GH01331p pro... 30 4.6 AE014297-4777|AAN14280.1| 1664|Drosophila melanogaster CG1815-PC... 30 4.6 AE014297-4776|AAF57177.2| 1674|Drosophila melanogaster CG1815-PA... 30 4.6 AE014297-3991|AAF56619.1| 81|Drosophila melanogaster CG14244-P... 29 8.1 >AY061259-1|AAL28807.1| 124|Drosophila melanogaster LD19086p protein. Length = 124 Score = 30.3 bits (65), Expect = 3.5 Identities = 15/34 (44%), Positives = 18/34 (52%) Frame = -3 Query: 108 PVK*QELSKPLIAKAAKDSLSPPTDPLVLERPPP 7 PV+ Q S P + KAA +PP PL R PP Sbjct: 27 PVRHQRKSPPALKKAAVPRRTPPPWPLKFRRNPP 60 >BT010115-1|AAQ22584.1| 1664|Drosophila melanogaster GH01331p protein. Length = 1664 Score = 29.9 bits (64), Expect = 4.6 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 81 PLIAKAAKDSLSP-PTDPLVLERPPPP 4 PL++ A S SP PT L + +PPPP Sbjct: 1078 PLLSTAPSPSASPKPTSTLAVSKPPPP 1104 >AE014297-4777|AAN14280.1| 1664|Drosophila melanogaster CG1815-PC, isoform C protein. Length = 1664 Score = 29.9 bits (64), Expect = 4.6 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 81 PLIAKAAKDSLSP-PTDPLVLERPPPP 4 PL++ A S SP PT L + +PPPP Sbjct: 1078 PLLSTAPSPSASPKPTSTLAVSKPPPP 1104 >AE014297-4776|AAF57177.2| 1674|Drosophila melanogaster CG1815-PA, isoform A protein. Length = 1674 Score = 29.9 bits (64), Expect = 4.6 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -3 Query: 81 PLIAKAAKDSLSP-PTDPLVLERPPPP 4 PL++ A S SP PT L + +PPPP Sbjct: 1088 PLLSTAPSPSASPKPTSTLAVSKPPPP 1114 >AE014297-3991|AAF56619.1| 81|Drosophila melanogaster CG14244-PA protein. Length = 81 Score = 29.1 bits (62), Expect = 8.1 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +2 Query: 590 YCLLPLKRTM*PSISTLIWFHYCNN*FRMPGKMRRSKGSAWTAWGWRQFRRPPA 751 YCL P K + +I++ H C + WTAW W+ + PP+ Sbjct: 22 YCLDPTKYWLCSAINSQAHLHKCQPNTGFDQDLNACV--PWTAWEWKPCQEPPS 73 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 38,330,591 Number of Sequences: 53049 Number of extensions: 813475 Number of successful extensions: 2032 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2029 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4065385896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -