BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0287.Seq (604 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57370.1 68418.m07168 expressed protein low similarity to nuc... 33 0.15 At5g01270.1 68418.m00036 double-stranded RNA-binding domain (DsR... 32 0.25 At3g17170.1 68416.m02190 ribosomal protein S6 family protein (RF... 32 0.34 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 31 0.44 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 31 0.44 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 31 0.44 At4g21270.1 68417.m03074 kinesin-like protein A (KATA) 31 0.78 At3g45140.1 68416.m04872 lipoxygenase (LOX2) identical to SP|P38418 31 0.78 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 30 1.4 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 30 1.4 At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing prote... 29 1.8 At1g78120.1 68414.m09104 tetratricopeptide repeat (TPR)-containi... 29 2.4 At5g54050.1 68418.m06722 DC1 domain-containing protein 28 4.1 At4g02030.1 68417.m00273 expressed protein 28 4.1 At3g56400.1 68416.m06272 WRKY family transcription factor DNA-bi... 28 5.5 At3g49500.1 68416.m05410 RNA-dependent RNA polymerase (SDE1) ide... 28 5.5 At3g19990.1 68416.m02529 expressed protein 28 5.5 At3g01060.3 68416.m00009 expressed protein 28 5.5 At3g01060.2 68416.m00007 expressed protein 28 5.5 At3g01060.1 68416.m00008 expressed protein 28 5.5 At5g40740.1 68418.m04944 expressed protein 27 7.2 At5g35840.1 68418.m04306 phytochrome C (PHYC) identical to SP|P1... 27 7.2 At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing ... 27 7.2 At4g39630.1 68417.m05601 expressed protein 27 7.2 At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesi... 27 7.2 At1g11925.1 68414.m01377 stigma-specific Stig1 family protein co... 27 7.2 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 27 9.6 At5g19300.1 68418.m02300 expressed protein contains Pfam profile... 27 9.6 At4g31820.1 68417.m04522 phototropic-responsive NPH3 family prot... 27 9.6 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 27 9.6 At3g19050.1 68416.m02420 kinesin motor protein-related contains ... 27 9.6 At1g75010.1 68414.m08709 MORN (Membrane Occupation and Recogniti... 27 9.6 At1g53470.1 68414.m06061 mechanosensitive ion channel domain-con... 27 9.6 At1g27650.1 68414.m03379 U2 snRNP auxiliary factor small subunit... 27 9.6 At1g01320.1 68414.m00048 tetratricopeptide repeat (TPR)-containi... 27 9.6 >At5g57370.1 68418.m07168 expressed protein low similarity to nucleic acid binding protein [Homo sapiens] GI:431953 Length = 219 Score = 33.1 bits (72), Expect = 0.15 Identities = 20/53 (37%), Positives = 28/53 (52%) Frame = +3 Query: 252 SRRDAGRRASQATEQREPAKAVRRKGQRSRTLDREADGRRHRHRNGPAGLSGR 410 S RD RR + + REP + RR+G+ R DR+ D R R R+ GL + Sbjct: 2 SERD--RRERERDKDREPDRD-RRRGRDDRDRDRDRDRERDRERDRDRGLRNK 51 >At5g01270.1 68418.m00036 double-stranded RNA-binding domain (DsRBD)-containing protein contains Pfam profile PF00035: Double-stranded RNA binding motif Length = 771 Score = 32.3 bits (70), Expect = 0.25 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = +1 Query: 301 NLRRQFAEKANAVGPWIERQMDAVTAIGMG--LQGSLEDQLRRLKEYEAGVYAY 456 N + F ++ A+ WI R+MD V GM L+ ++D++ LK+Y YA+ Sbjct: 153 NTMKSFEDRIEALKSWISREMDPVRINGMSAELKRYMDDRM-LLKQYIDNDYAF 205 >At3g17170.1 68416.m02190 ribosomal protein S6 family protein (RFC3) annotation temporarily based on supporting cDNA gi|15620809|dbj|AB057424.1|; contains TIGRfam TIGR00166 and Pfam PF01250 profiles ribosomal protein S6. Length = 314 Score = 31.9 bits (69), Expect = 0.34 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +1 Query: 379 IGMGLQGSLEDQLRRLKEYEAGVYAYKPHIEELERIHQAVQEGRSSKTG 525 + + LQ L ++ R++ YE ++ H EE+E I+Q VQ+ K G Sbjct: 107 LDLQLQSDLNEE--RMRHYEVVYLIHEKHAEEVESINQKVQDYLKEKKG 153 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 31.5 bits (68), Expect = 0.44 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = +3 Query: 249 RSRRDAGRRASQATEQREPAKAVRRKGQRSRTLDREADGRRHR-HRNGPAGLSGRPAAQT 425 RSRR R +++RE K++ + + T DR+ D RRH+ + P Sbjct: 124 RSRRSRSRSERHRSQERE--KSLEIEPKERETKDRDRDRRRHKDKKEDKVEPEADPERDQ 181 Query: 426 *RVRSWSVRLQATHR 470 V ++ + L+AT R Sbjct: 182 RTVFAYQIALRATER 196 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 31.5 bits (68), Expect = 0.44 Identities = 29/72 (40%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +1 Query: 1 RRSRGYVHRSYHRRNLRSH----GRSRSLQGNPRRG*QRIPGYRQPGTSSRIYCQAAPDP 168 RR R RS RR RS GRSRS +PR+G R P R+ +SS ++P P Sbjct: 312 RRLRSPPRRSPIRRRSRSPIRRPGRSRSSSISPRKG--RGPAGRRGRSSS---YSSSPSP 366 Query: 169 RRFGEPIHHSHS 204 RR I S S Sbjct: 367 RRIPRKISRSRS 378 Score = 27.1 bits (57), Expect = 9.6 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = +1 Query: 28 SYHRRNLRSHGRSRSLQGNPRRG*QRIPGYRQPGTSSRIYCQAAPDPRRFGEP 186 S RR+ S R R G+P R P R+P + SR ++P PRR+ P Sbjct: 233 SPRRRSPDSPHRRRP--GSPIRRRGDTPPRRRPASPSRGRSPSSPPPRRYRSP 283 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 31.5 bits (68), Expect = 0.44 Identities = 29/72 (40%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +1 Query: 1 RRSRGYVHRSYHRRNLRSH----GRSRSLQGNPRRG*QRIPGYRQPGTSSRIYCQAAPDP 168 RR R RS RR RS GRSRS +PR+G R P R+ +SS ++P P Sbjct: 319 RRLRSPPRRSPIRRRSRSPIRRPGRSRSSSISPRKG--RGPAGRRGRSSS---YSSSPSP 373 Query: 169 RRFGEPIHHSHS 204 RR I S S Sbjct: 374 RRIPRKISRSRS 385 Score = 27.1 bits (57), Expect = 9.6 Identities = 19/53 (35%), Positives = 26/53 (49%) Frame = +1 Query: 28 SYHRRNLRSHGRSRSLQGNPRRG*QRIPGYRQPGTSSRIYCQAAPDPRRFGEP 186 S RR+ S R R G+P R P R+P + SR ++P PRR+ P Sbjct: 240 SPRRRSPDSPHRRRP--GSPIRRRGDTPPRRRPASPSRGRSPSSPPPRRYRSP 290 >At4g21270.1 68417.m03074 kinesin-like protein A (KATA) Length = 793 Score = 30.7 bits (66), Expect = 0.78 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 2/79 (2%) Frame = +1 Query: 298 ENLRRQFAEKANA-VGPWIERQMDAVTAIGMGLQGSLEDQLRRLKEYEAGVYAYKPHIE- 471 E R AEK A +G +++ + A + SLED +RL+EY + Y ++ Sbjct: 183 EKEARVAAEKVQASLGEELDKVKEEKMAAKQKVT-SLEDMYKRLQEYNTSLQQYNSKLQT 241 Query: 472 ELERIHQAVQEGRSSKTGI 528 +LE + A+ K+ I Sbjct: 242 DLETVRAALTRAEKEKSSI 260 >At3g45140.1 68416.m04872 lipoxygenase (LOX2) identical to SP|P38418 Length = 896 Score = 30.7 bits (66), Expect = 0.78 Identities = 23/71 (32%), Positives = 32/71 (45%) Frame = -2 Query: 555 REEPPLCIVNTCFRRSAFLDSLVDAFEFLDVWLVSVHSSFVLFKSAQLVFQRALQAHSDG 376 R+E T F A L +L F ++ L+S F FK+ Q +F+ +Q D Sbjct: 299 RDEEFSTAKGTSFTGKAVLAALPSIFPQIESVLLSPQEPFPHFKAIQNLFEEGIQLPKDA 358 Query: 375 GDGVHLPLDPR 343 G LPL PR Sbjct: 359 G---LLPLLPR 366 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 Query: 215 NRKXSDVRQLVPQPTRRWPQSFASNRTTRTCEGSSQKRPTQSDLGSRGRWTPSPPS 382 N S R L P RR P+S + +T+ E S KR + R +P P+ Sbjct: 203 NESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPA 258 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 29.9 bits (64), Expect = 1.4 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +2 Query: 215 NRKXSDVRQLVPQPTRRWPQSFASNRTTRTCEGSSQKRPTQSDLGSRGRWTPSPPS 382 N S R L P RR P+S + +T+ E S KR + R +P P+ Sbjct: 203 NESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPA 258 >At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing protein contains Pfam domain PF03194: LUC7 N_terminus Length = 402 Score = 29.5 bits (63), Expect = 1.8 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Frame = +3 Query: 249 RSRRDAGRRASQATEQ-----REPAKAVRRKGQRSRTLDREADGRRHRHRN 386 R RD R + EQ R +++ RR RSR+ DR D RHR N Sbjct: 350 RRSRDRDRHHDRDREQDRDYDRSHSRSRRRSRSRSRSRDRPRDYDRHRRHN 400 >At1g78120.1 68414.m09104 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q99615 DnaJ homolog subfamily C member 7 (Tetratricopeptide repeat protein 2) {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 530 Score = 29.1 bits (62), Expect = 2.4 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 4/97 (4%) Frame = +1 Query: 322 EKANAVGPWIERQMDAVTAIGMGLQGSLEDQLRRLKEYEAGVYAYKPHIEELERIHQAVQ 501 E+A + P ER + ++ + L G +E L E AG Y HIE++E + + ++ Sbjct: 217 EEALRLNPTYERAHQRLASLQLRL-GEVEKALCHYNE--AGKYTETKHIEQVEDVVKCLR 273 Query: 502 ---EGRSSKTGIHNTQWRLFA-SAGNSS*PRSTAPST 600 E R SK + LFA S G S PR A T Sbjct: 274 RCDEARRSKEWNVALKETLFAISYGADSSPRVYALQT 310 >At5g54050.1 68418.m06722 DC1 domain-containing protein Length = 580 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +1 Query: 133 SSRIYCQAAPDPRRFGEPIHHSHS 204 S I C A P P EP HH HS Sbjct: 142 SLHIGCVAEPPPLTISEPKHHKHS 165 >At4g02030.1 68417.m00273 expressed protein Length = 694 Score = 28.3 bits (60), Expect = 4.1 Identities = 25/86 (29%), Positives = 39/86 (45%) Frame = +2 Query: 188 YTTLTAHELNRKXSDVRQLVPQPTRRWPQSFASNRTTRTCEGSSQKRPTQSDLGSRGRWT 367 Y + HEL +V+Q++PQ T R + SN + T SS+ +D +R Sbjct: 508 YVDMFLHELEEVGKEVKQVLPQGTFRKHKRTDSNGSNTTT--SSRSNTLHNDKMARSN-- 563 Query: 368 PSPPSEWACRALWKTSCADLKSTKLE 445 S+ A L++T A L K+E Sbjct: 564 ----SQRARSQLFETHLAKLFKQKVE 585 >At3g56400.1 68416.m06272 WRKY family transcription factor DNA-binding protein 4 WRKY4 - Nicotiana tabacum, EMBL:AF193771 Length = 294 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/68 (25%), Positives = 29/68 (42%), Gaps = 1/68 (1%) Frame = +2 Query: 392 CRALWKTSCADLKSTKLECTLTSHTSRNSNASTRLSRKADLRKQVFTIHNGGSSRRLGTA 571 C+A + +L+ T + + N+NA T S+ D ++F S L T+ Sbjct: 153 CKATKQVQKVELEPKMFSITYIGNHTCNTNAETPKSKTCDHHDEIFMDSEDHKSPSLSTS 212 Query: 572 -PDLDQPH 592 + D PH Sbjct: 213 MKEEDNPH 220 >At3g49500.1 68416.m05410 RNA-dependent RNA polymerase (SDE1) identical to RNA-dependent RNA polymerase [Arabidopsis thaliana] gi|8248473|gb|AAF74208 Length = 1196 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/52 (32%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = +2 Query: 179 ENPYTTLTAHELNRKXSDVRQLVPQPTRRW---PQSFASNRTTRTCEGSSQK 325 +NP L +HE + S++R+LV PTR + P+ SNR R + +++ Sbjct: 394 KNP-KLLGSHEQSEDISEIRRLVITPTRAYCLPPEVELSNRVLRRYKAVAER 444 >At3g19990.1 68416.m02529 expressed protein Length = 425 Score = 27.9 bits (59), Expect = 5.5 Identities = 22/78 (28%), Positives = 34/78 (43%), Gaps = 4/78 (5%) Frame = -2 Query: 516 RRSAFLDSLVDAFEFLDVWLVSVHSSFV-LFKSA--QLVFQRALQAHSDGGDGVHLPL-D 349 + +FLD L+D ++ L +W LF SA A+ S G D V + + Sbjct: 50 KHGSFLDHLIDIYKILKLWKAPESVCLCGLFHSAYSNSYVNLAIFDPSTGRDVVRDHVGE 109 Query: 348 PRSDCVGLFCELPSQVLV 295 + LFC +P Q L+ Sbjct: 110 AAESLIHLFCVVPRQTLI 127 >At3g01060.3 68416.m00009 expressed protein Length = 372 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 378 GGDGVHLPLDPRSDCVGLFCELPSQVLVVLL 286 GG VH P+ P +CV L EL + V ++L Sbjct: 132 GGLWVHAPIAPTKECVQLIKELGAPVEYIVL 162 >At3g01060.2 68416.m00007 expressed protein Length = 442 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 378 GGDGVHLPLDPRSDCVGLFCELPSQVLVVLL 286 GG VH P+ P +CV L EL + V ++L Sbjct: 127 GGLWVHAPIAPTKECVQLIKELGAPVEYIVL 157 >At3g01060.1 68416.m00008 expressed protein Length = 455 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 378 GGDGVHLPLDPRSDCVGLFCELPSQVLVVLL 286 GG VH P+ P +CV L EL + V ++L Sbjct: 132 GGLWVHAPIAPTKECVQLIKELGAPVEYIVL 162 >At5g40740.1 68418.m04944 expressed protein Length = 741 Score = 27.5 bits (58), Expect = 7.2 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = +2 Query: 161 QIPGGLENPYTTLTAHELNRKXSDVRQLVPQPTRRWPQSFASNRTTRTCEGSSQKRPTQS 340 +I G+ N LT+ N + V PT + PQ F+S T+ G+ QKR T + Sbjct: 488 RIMEGVSNDVAELTSTMSNVQLEKVSA---SPTLKLPQLFSSTPTSSGKGGNGQKRQTMA 544 >At5g35840.1 68418.m04306 phytochrome C (PHYC) identical to SP|P14714 Phytochrome C {Arabidopsis thaliana} Length = 1111 Score = 27.5 bits (58), Expect = 7.2 Identities = 8/24 (33%), Positives = 19/24 (79%) Frame = +1 Query: 343 PWIERQMDAVTAIGMGLQGSLEDQ 414 PW + +MDA+ ++ + ++GSL+++ Sbjct: 557 PWDDMEMDAINSLQLIIKGSLQEE 580 >At5g10800.1 68418.m01255 RNA recognition motif (RRM)-containing protein KIAA0332 gene, Homo sapiens, EMBL:HSAB2330 Length = 947 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 258 RDAGRRASQATEQREPAKAVRRKGQRSRTLDREADGRRHRHRN 386 RD+ R+ +++ Q ++ R R D + D RHR R+ Sbjct: 865 RDSSRKRNRSESQNRSQSPPQKSLTRERVRDHDLDKDRHRDRD 907 >At4g39630.1 68417.m05601 expressed protein Length = 233 Score = 27.5 bits (58), Expect = 7.2 Identities = 22/92 (23%), Positives = 41/92 (44%), Gaps = 1/92 (1%) Frame = +1 Query: 274 ELRKQQNNENLRRQFAEKA-NAVGPWIERQMDAVTAIGMGLQGSLEDQLRRLKEYEAGVY 450 +L ++ N+ R + EK + V +ERQ+ A+ AI + LR L+ Y Sbjct: 11 KLTEEDRNDEKRIRIEEKKEDFVDEEVERQIAAIRAIRDVEIEQMLTALRLLRSYFTEEQ 70 Query: 451 AYKPHIEELERIHQAVQEGRSSKTGIHNTQWR 546 + P ++ + + R+ +TG +WR Sbjct: 71 LHTPVLDFFKENLPDLSISRNEETGEIELKWR 102 >At4g05190.1 68417.m00781 kinesin-like protein A, putative kinesin like protein A, Arabidopsis thaliana, gb:Q07970 Length = 790 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/44 (31%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +1 Query: 400 SLEDQLRRLKEYEAGVYAYKPHIE-ELERIHQAVQEGRSSKTGI 528 SLED +RL+EY + Y ++ +LE +A K+ I Sbjct: 214 SLEDMYKRLQEYNTSLQQYNTKLQTDLEVAREAHTRAEKEKSSI 257 >At1g11925.1 68414.m01377 stigma-specific Stig1 family protein contains Pfam profile PF04885: Stigma-specific protein, Stig1 Length = 121 Score = 27.5 bits (58), Expect = 7.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +2 Query: 407 KTSCADLKSTKLECTLTSHTSRNSNASTRLSRKAD 511 + C DL++ KL C + + S + R +RK D Sbjct: 68 RKKCVDLRTNKLNCGRCGKSCQYSEVALRSARKGD 102 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/75 (24%), Positives = 28/75 (37%), Gaps = 2/75 (2%) Frame = +1 Query: 274 ELRKQQNNENLRRQFAEKANAVGPWIER--QMDAVTAIGMGLQGSLEDQLRRLKEYEAGV 447 E++ ++ E RR+F K W ++ Q T G + + E V Sbjct: 645 EMKLKEKCEETRREFIRKKQGFEDWYQKHLQKRGPTEEAEGGDDATTSSRDHVTERRIAV 704 Query: 448 YAYKPHIEELERIHQ 492 K +EE E HQ Sbjct: 705 ETLKKRLEEEEEAHQ 719 >At5g19300.1 68418.m02300 expressed protein contains Pfam profile PF02598: Uncharacterized ACR, COG2106 Length = 398 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 512 LRKQVFTIHNGGSSRRLGTAPDLDQPHHQR 601 LRK +F N R +G P LD PHH R Sbjct: 179 LRKSLFPKQN--DLRYVGMLPPLDAPHHLR 206 >At4g31820.1 68417.m04522 phototropic-responsive NPH3 family protein contains NPH3 family domain, Pfam:PF03000 Length = 571 Score = 27.1 bits (57), Expect = 9.6 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Frame = +2 Query: 239 QLVPQPTRR-----WP-QSFASNRTTRTCEGSSQKRPTQSDLGSRGR 361 QL+P +RR WP + SN+++ GSSQ P +S S R Sbjct: 519 QLMPSRSRRIFEKIWPGKGEISNKSSEVSSGSSQSPPAKSSSSSSRR 565 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 27.1 bits (57), Expect = 9.6 Identities = 20/46 (43%), Positives = 24/46 (52%) Frame = +1 Query: 49 RSHGRSRSLQGNPRRG*QRIPGYRQPGTSSRIYCQAAPDPRRFGEP 186 RSHGRSRS + R +R P + SR Y +P PRR G P Sbjct: 150 RSHGRSRSRSISRSRSPRR-PSDSRSRYRSRSY---SPAPRRRGGP 191 >At3g19050.1 68416.m02420 kinesin motor protein-related contains Pfam profile: PF00225 Kinesin motor domain; contains non-consensus splice site (GC) at intron 12 Length = 2722 Score = 27.1 bits (57), Expect = 9.6 Identities = 22/91 (24%), Positives = 40/91 (43%) Frame = +1 Query: 289 QNNENLRRQFAEKANAVGPWIERQMDAVTAIGMGLQGSLEDQLRRLKEYEAGVYAYKPHI 468 +N N+ + AE+ +E ++ + + + E+ R L E + K HI Sbjct: 2269 ENKVNVVKDEAERQRLQREELEMELHTIRQQMESARNADEEMKRILDEKHMDLAQAKKHI 2328 Query: 469 EELERIHQAVQEGRSSKTGIHNTQWRLFASA 561 E LER + A Q+ ++ H ++ L A A Sbjct: 2329 EALER-NTADQKTEITQLSEHISELNLHAEA 2358 >At1g75010.1 68414.m08709 MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein /phosphatidylinositol-4-phosphate 5-kinase-related low similarity to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profile PF02493: MORN repeat Length = 712 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 473 NSNASTRLSRKADLRKQVFTIHNGGSSRRLGTAPDL 580 N + +++LSRKAD R++ F NG + TA L Sbjct: 482 NLSVASQLSRKADSREESFFNPNGSTKDSSDTASTL 517 >At1g53470.1 68414.m06061 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 881 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/58 (31%), Positives = 25/58 (43%) Frame = +3 Query: 9 SWICSSFIPSKKSQVSWTLTLASRQPSARLTKNTRLSSTWYIKSNLLSSSTRSPAVWR 182 S ICS IP + + W L L + + RL S+W +K L S +WR Sbjct: 272 SLICSLVIPYLRGKTLWDLALWKWEVMVLVLICGRLVSSWIVK--LFVYFVESNFLWR 327 >At1g27650.1 68414.m03379 U2 snRNP auxiliary factor small subunit, putative Strong similarity to gb|Y18349 U2 snRNP auxiliary factor, small subunit from Oryza sativa. ESTs gb|AA586295 and gb|AA597332 come from this gene Length = 296 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 1 RRSRGYVHRSYHRRNLRSHGRSRSLQ-GNPRRG*QRIPGYRQ 123 R+ G RSY RR RS RSRS+ N R +R P +R+ Sbjct: 182 RKLFGRYRRSY-RRGSRSRSRSRSISPRNKRDNDRRDPSHRE 222 >At1g01320.1 68414.m00048 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|P46825 Kinesin light chain (KLC) {Loligo pealeii}; contains Pfam profile PF00515: TPR Domain Length = 1797 Score = 27.1 bits (57), Expect = 9.6 Identities = 31/135 (22%), Positives = 48/135 (35%), Gaps = 3/135 (2%) Frame = +2 Query: 80 ATLGEADKEYQ---AIVNLVHQVESIVKQHQIPGGLENPYTTLTAHELNRKXSDVRQLVP 250 ATLG +Y A+V L + E + QI LE P A +N + + P Sbjct: 448 ATLGTISLKYCGYIAVVKLEKESEELSPPSQIVDLLEQPEGGANALNINSLRFLLHKSSP 507 Query: 251 QPTRRWPQSFASNRTTRTCEGSSQKRPTQSDLGSRGRWTPSPPSEWACRALWKTSCADLK 430 + ++ PQ T+ S + + L W A W D K Sbjct: 508 EQNKKTPQQHDDELTSSREFVSKMLEESIAKLEGE-EIDRDSIMRWELGACWIQHLQDQK 566 Query: 431 STKLECTLTSHTSRN 475 +T+ + T S+N Sbjct: 567 NTEKDKKQTGEKSKN 581 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,599,293 Number of Sequences: 28952 Number of extensions: 315871 Number of successful extensions: 1249 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1150 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1246 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -