BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0286.Seq (627 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 31 0.030 AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methy... 25 1.5 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 7.9 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 31.1 bits (67), Expect = 0.030 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 466 RTITETVYCRNTRQRLGGGLETALACKYRIAVKDSKTGFGLPEVMLGLLPGG 621 R I + + C T + GGLE AL C R+ +++ GF + L+ GG Sbjct: 136 RMIRKPLVCAITGYCVAGGLELALMCDLRVMEENAVLGFFNRRFGVPLIDGG 187 >AF532982-1|AAQ10289.1| 459|Anopheles gambiae putative RNA methylase protein. Length = 459 Score = 25.4 bits (53), Expect = 1.5 Identities = 15/53 (28%), Positives = 31/53 (58%), Gaps = 3/53 (5%) Frame = +2 Query: 323 SGIEAAVIISGKPGCFIAGADIS-MIENCKTKEEVVS--LSKRGHEIFRRIEQ 472 +G + ++ + K G ++AGADI MI + K+K V+ + ++ I+ ++Q Sbjct: 226 AGSGSLLVAAAKFGAYVAGADIDYMIVHGKSKPTRVNQKVREKDESIYANLQQ 278 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.0 bits (47), Expect = 7.9 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -2 Query: 605 PNMTSGSPNPVLESFTAMRYLHARAVSNPPP 513 P+ S +PV + +LH A PPP Sbjct: 802 PHSALSSHSPVGAGSHHLHHLHHHAAQQPPP 832 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 617,225 Number of Sequences: 2352 Number of extensions: 13039 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -