BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0283.Seq (712 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0407 + 2901321-2901739,2902673-2902825,2902899-2902981,290... 31 0.68 09_06_0018 + 20256603-20256881,20257003-20257200 29 3.6 >06_01_0407 + 2901321-2901739,2902673-2902825,2902899-2902981, 2903081-2903180,2904580-2904693,2905292-2905434, 2905825-2905919 Length = 368 Score = 31.5 bits (68), Expect = 0.68 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -3 Query: 200 RSISLPRIRAICRLISLRGLVSVRDSFGWTRRATPRA 90 R +S P A C L L G ++ SF W+ + PRA Sbjct: 21 RILSTPAFSAACLLFGLAGFLAAALSFSWSPGSAPRA 57 >09_06_0018 + 20256603-20256881,20257003-20257200 Length = 158 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 148 VDSCRFETRSGGLAAPRLAPRGTYALIMSA 59 V SC TRS + PRL PR AL + A Sbjct: 21 VSSCATRTRSTASSTPRLTPRAATALRLEA 50 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,383,587 Number of Sequences: 37544 Number of extensions: 327692 Number of successful extensions: 681 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 672 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -