BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0275.Seq (686 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0332 + 4378111-4378329,4378862-4378997,4379113-4379165,437... 28 6.0 >04_01_0332 + 4378111-4378329,4378862-4378997,4379113-4379165, 4379286-4379394,4379467-4379603,4379698-4379894, 4379979-4380128,4380233-4380293,4380380-4380500, 4380901-4380991,4381116-4381209,4381446-4381541, 4382176-4382316,4382592-4382642,4383093-4383161, 4384072-4384142,4384244-4384336,4384820-4384910, 4386164-4386235,4387226-4387351,4387537-4387593, 4387926-4388000,4388570-4388658,4388814-4388891, 4389308-4389446,4389868-4389977,4390151-4390250, 4390548-4390655 Length = 977 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 522 ENSNNWHLIKIAFIQNIFMVQMRNFKRKTFDRYVRIIAELSLNPL 656 +N NWHLIK ++N ++N FD +V I+ +PL Sbjct: 819 KNEENWHLIK-PRLENPSFRPLKNHILSVFDNFVDILKIRYSSPL 862 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,010,157 Number of Sequences: 37544 Number of extensions: 300389 Number of successful extensions: 489 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -