BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0274.Seq (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 50 7e-08 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 50 7e-08 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 50 7e-08 AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. 29 0.13 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 25 1.2 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 25 1.2 DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. 25 1.6 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 24 2.9 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 24 2.9 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 24 2.9 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 24 2.9 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 24 2.9 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 24 2.9 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 24 2.9 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 8.8 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 8.8 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 49.6 bits (113), Expect = 7e-08 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = -1 Query: 217 GFKQRLALACSLMHEPDILFLDEPTSGVDPITRREFWLHINSMVEKGVTVMVTTHFMDEA 38 G ++RLA A + +P +L DEPTSG+D + M KG T+++T H Sbjct: 247 GERKRLAFASETLTDPHLLLCDEPTSGLDSFMAHSVLQVLKGMAMKGKTIILTIHQPSSE 306 Query: 37 EYC--DRIGLVYRG 2 YC D+I LV G Sbjct: 307 LYCLFDKILLVAEG 320 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 49.6 bits (113), Expect = 7e-08 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = -1 Query: 217 GFKQRLALACSLMHEPDILFLDEPTSGVDPITRREFWLHINSMVEKGVTVMVTTHFMDEA 38 G ++RLA A + +P +L DEPTSG+D + M KG T+++T H Sbjct: 247 GERKRLAFASETLTDPHLLLCDEPTSGLDSFMAHSVLQVLKGMAMKGKTIILTIHQPSSE 306 Query: 37 EYC--DRIGLVYRG 2 YC D+I LV G Sbjct: 307 LYCLFDKILLVAEG 320 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 49.6 bits (113), Expect = 7e-08 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = -1 Query: 217 GFKQRLALACSLMHEPDILFLDEPTSGVDPITRREFWLHINSMVEKGVTVMVTTHFMDEA 38 G ++RLA A + +P +L DEPTSG+D + M KG T+++T H Sbjct: 225 GERKRLAFASETLTDPHLLLCDEPTSGLDSFMAHSVLQVLKGMAMKGKTIILTIHQPSSE 284 Query: 37 EYC--DRIGLVYRG 2 YC D+I LV G Sbjct: 285 LYCLFDKILLVAEG 298 Score = 23.0 bits (47), Expect = 6.6 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +2 Query: 257 RPNASLMREIFSFCARPRKPYTPEK 331 +P L + S C R RK + P K Sbjct: 67 KPREPLCTRLRSCCTRQRKDFNPRK 91 >AY659930-1|AAT51798.2| 144|Anopheles gambiae lysozyme c-3 protein. Length = 144 Score = 28.7 bits (61), Expect = 0.13 Identities = 20/71 (28%), Positives = 30/71 (42%) Frame = -1 Query: 532 LVFLGQTAG*IDHL*DDVRFAGADFRPRRWCWGWI*KRVPVKRASISAIWRKNFRSTVTD 353 L LG T G + + + VR A+ PR WI R SA+ +KN+ + Sbjct: 10 LAVLGTTYGKVFNKCELVRLLAANGFPRSQLQDWICLIQNESRYDTSALNKKNWNGSKDY 69 Query: 352 GRTEFTLFLWC 320 G + + WC Sbjct: 70 GIFQINNYYWC 80 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 1.2 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 311 KPYTPEKKRKFCSTVSYRRAKIFA--PYSRDAGALYRNSLSDPSPA 442 +PY K + CS+ A PY D+ ++S S PSPA Sbjct: 227 RPYDISKSPRLCSSNGSSSATPLPLHPYHTDSDCSTQDSTSAPSPA 272 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 25.4 bits (53), Expect = 1.2 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 311 KPYTPEKKRKFCSTVSYRRAKIFA--PYSRDAGALYRNSLSDPSPA 442 +PY K + CS+ A PY D+ ++S S PSPA Sbjct: 227 RPYDISKSPRLCSSNGSSSATPLPLHPYHTDSDCSTQDSTSAPSPA 272 >DQ004402-1|AAY21241.1| 144|Anopheles gambiae lysozyme c-8 protein. Length = 144 Score = 25.0 bits (52), Expect = 1.6 Identities = 20/71 (28%), Positives = 28/71 (39%) Frame = -1 Query: 532 LVFLGQTAG*IDHL*DDVRFAGADFRPRRWCWGWI*KRVPVKRASISAIWRKNFRSTVTD 353 L LG T G + + + VR A+ PR WI R SA+ KN + Sbjct: 10 LAVLGTTYGKVFNKCELVRLLAANGFPRSQLQDWICLIQNESRYDTSALNTKNRDGSKDY 69 Query: 352 GRTEFTLFLWC 320 G + + WC Sbjct: 70 GIFQINNYYWC 80 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 24.2 bits (50), Expect = 2.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 427 RSIPSTSAWAGSRHQQTAHHL 489 R I SAW G RH + HL Sbjct: 963 RIIRDISAWQGRRHGEMTFHL 983 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 2.9 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 112 FWLHINSMVEKGVTVMVTTHFMDEAEYCDRIGLV 11 +W HI + V + F DE Y D+ GL+ Sbjct: 166 YWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 2.9 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 112 FWLHINSMVEKGVTVMVTTHFMDEAEYCDRIGLV 11 +W HI + V + F DE Y D+ GL+ Sbjct: 166 YWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 2.9 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 112 FWLHINSMVEKGVTVMVTTHFMDEAEYCDRIGLV 11 +W HI + V + F DE Y D+ GL+ Sbjct: 166 YWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 2.9 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 112 FWLHINSMVEKGVTVMVTTHFMDEAEYCDRIGLV 11 +W HI + V + F DE Y D+ GL+ Sbjct: 166 YWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 24.2 bits (50), Expect = 2.9 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 112 FWLHINSMVEKGVTVMVTTHFMDEAEYCDRIGLV 11 +W HI + V + F DE Y D+ GL+ Sbjct: 166 YWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 199 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 24.2 bits (50), Expect = 2.9 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -1 Query: 112 FWLHINSMVEKGVTVMVTTHFMDEAEYCDRIGLV 11 +W HI + V + F DE Y D+ GL+ Sbjct: 393 YWFHIKYFFKIMKNSAVLSFFNDEKLYLDKSGLL 426 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 8.8 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -1 Query: 238 ATDELPLGFKQRLALACSLMHEPDILFLDE 149 A + K+ + LAC L HE +L +E Sbjct: 754 AASKFQKNLKRGIYLACVLYHEDKLLLTNE 783 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 22.6 bits (46), Expect = 8.8 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 348 EQNLRFFSGVYGLRGRAQ-NEKISRMSEAFGLKVSPPTPPM 229 +Q L F V + RA NE E +VSPP PP+ Sbjct: 1069 QQRLGDFELVPAVLARAAANEAAEPTGEVEEEEVSPPVPPI 1109 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 658,243 Number of Sequences: 2352 Number of extensions: 14917 Number of successful extensions: 46 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 42 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -