BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0272.Seq (597 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC36.02c |||spermidine family transporter |Schizosaccharomyces... 29 0.68 SPBPB8B6.03 ||SPAPB8B6.03, SPAPB8B6.03|acetamidase |Schizosaccha... 27 2.7 SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe... 25 6.3 >SPBC36.02c |||spermidine family transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 28.7 bits (61), Expect = 0.68 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -1 Query: 165 ISIVGKNLILSKWKV---NPLCYYLTTFDSFCYKIL 67 +S + KN +L K+ P+C+ +T + SF Y IL Sbjct: 348 LSDIAKNYLLVPMKLLFTEPICFLITLYSSFVYAIL 383 >SPBPB8B6.03 ||SPAPB8B6.03, SPAPB8B6.03|acetamidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 547 Score = 26.6 bits (56), Expect = 2.7 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +3 Query: 180 LSHLHKYNYNAVSINL 227 +S+LH Y YNA++INL Sbjct: 189 VSNLHGYTYNALNINL 204 >SPBC887.19 |rft1||human RFT1 ortholog |Schizosaccharomyces pombe|chr 2|||Manual Length = 527 Score = 25.4 bits (53), Expect = 6.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 489 GSCRLLTYICVYVCVRASVRGARTFRCIHYIYL*ST 382 GS R+LT+ + +R + A F IH+ L ST Sbjct: 23 GSSRILTFFLNQLTIRLTSPSAYAFSSIHFEILQST 58 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,314,953 Number of Sequences: 5004 Number of extensions: 47285 Number of successful extensions: 103 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -