BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0270.Seq (675 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0982 - 33303500-33304011,33304091-33304208,33304606-333047... 30 1.9 >02_05_0982 - 33303500-33304011,33304091-33304208,33304606-33304726, 33304811-33304877,33304968-33305102,33305186-33305297, 33305852-33306009,33306177-33306300,33306406-33306542, 33307284-33307403,33307878-33308025,33308674-33308931, 33309090-33309127,33309232-33309674,33309761-33309845, 33310063-33310123,33310277-33310453,33311611-33312408, 33314394-33314693 Length = 1303 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +2 Query: 404 TGVSFIFLKTLNVYDKTTLTICSCACVASRV 496 T + +FL +LN++ K L IC CA + +R+ Sbjct: 930 TALFQVFLLSLNLFIKVKLQICECAVMTNRL 960 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,418,390 Number of Sequences: 37544 Number of extensions: 280043 Number of successful extensions: 507 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -