BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0270.Seq (675 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 24 3.8 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 24 5.0 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 23 6.7 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 23 6.7 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 23 6.7 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 24.2 bits (50), Expect = 3.8 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -3 Query: 568 YLSRCSGCQQPSRRTRSVNSASFKDAAGHT-STGTNR 461 ++ +CS C P+ SV+ A + HT TG +R Sbjct: 33 FVMQCSTCNAPTDSANSVSCAGVCGSKHHTHCTGLSR 69 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 7 NQYKLYF*RGRYFYLHLYSLQESQYRQQV 93 N+Y Y R +LHLY+L ++ Y + V Sbjct: 43 NRYIAYGWALRIMFLHLYALTQALYFKDV 71 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 6.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 7 NQYKLYF*RGRYFYLHLYSLQESQYRQQV 93 N+Y Y R +LHLY+L ++ Y + V Sbjct: 9 NRYIAYGWALRIVFLHLYALTQALYFKDV 37 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 6.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 7 NQYKLYF*RGRYFYLHLYSLQESQYRQQV 93 N+Y Y R +LHLY+L ++ Y + V Sbjct: 9 NRYIAYGWALRIVFLHLYALTQALYFKDV 37 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 6.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 7 NQYKLYF*RGRYFYLHLYSLQESQYRQQV 93 N+Y Y R +LHLY+L ++ Y + V Sbjct: 9 NRYIAYGWALRIVFLHLYALTQALYFKDV 37 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,449 Number of Sequences: 2352 Number of extensions: 13527 Number of successful extensions: 21 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -