BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0270.Seq (675 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-3544|AAF46957.1| 89|Drosophila melanogaster CG9873-PA... 29 7.7 >AE013599-3544|AAF46957.1| 89|Drosophila melanogaster CG9873-PA protein. Length = 89 Score = 28.7 bits (61), Expect = 7.7 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 562 SRCSGCQQPSRRTRSVNSASFKDAAGHTSTGTNR 461 S+CS C P+ +TRS N + + A G + GT R Sbjct: 32 SKCSQCGYPAAKTRSFNWS--RKAKGRKAQGTGR 63 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,977,266 Number of Sequences: 53049 Number of extensions: 525253 Number of successful extensions: 930 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 915 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 930 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2930645700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -