Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pg--0270.Seq
         (675 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g23640.1 68417.m03404 potassium transporter / tiny root hair ...    30   1.6  

>At4g23640.1 68417.m03404 potassium transporter / tiny root hair 1
           protein (TRH1) identical to tiny root hair 1 protein
           [Arabidopsis thaliana] gi|11181958|emb|CAC16137;
           KUP/HAK/KT Transporter family member, PMID:11500563;
           identical to cDNA mRNA for tiny root hair 1 protein
           (trh1) GI:11181957
          Length = 775

 Score = 29.9 bits (64), Expect = 1.6
 Identities = 20/55 (36%), Positives = 31/55 (56%)
 Frame = -2

Query: 266 LFVLF*NYLFEGILVAQAEAASAEGGDISLQPNLYFLTKTYVEHFSHCLVRFICN 102
           LF+LF   + E I VA A     +GG I+L  +L+F   TYV H+     +++C+
Sbjct: 441 LFILFFGTI-ELIFVASALVKIPKGGWITLLLSLFFTFITYVWHYG-SRKKYLCD 493


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,946,201
Number of Sequences: 28952
Number of extensions: 243714
Number of successful extensions: 452
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 450
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 452
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1432596384
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)