BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0267X.Seq (603 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 24 0.86 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 24 1.1 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.0 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 24.2 bits (50), Expect = 0.86 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = -3 Query: 88 LGPESK--NLNIPVYFNVLLFCTINSY 14 L PE + +L I Y+N+L FC I Y Sbjct: 315 LVPEEQVYHLEIEKYYNILYFCRIMVY 341 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 23.8 bits (49), Expect = 1.1 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 1/44 (2%) Frame = +1 Query: 1 FFLFYNYLLYKTI-IH*NIQVCLNFWTQVPNTGQSSKIILPLQT 129 F LFY + YKTI H + L++ P S ILPL T Sbjct: 14 FLLFYLFYCYKTIKQHIYSLISLSYLPGPPVNDIISGNILPLYT 57 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 1 FFLFYNYLLYKTI 39 F LFY + YKTI Sbjct: 14 FLLFYLFYCYKTI 26 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 128,799 Number of Sequences: 336 Number of extensions: 2566 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15248386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -