BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0260X.Seq (315 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|c... 29 0.13 SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 27 0.51 SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual 26 1.5 SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|c... 25 3.6 SPBC16D10.04c |dna2||DNA replication endonuclease-helicase Dna2|... 24 4.7 SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosa... 23 8.3 SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Sch... 23 8.3 SPAC1687.04 |||conserved eukaryotic protein|Schizosaccharomyces ... 23 8.3 SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3... 23 8.3 >SPAC1F3.04c |||DUF367 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 288 Score = 29.5 bits (63), Expect = 0.13 Identities = 17/60 (28%), Positives = 35/60 (58%), Gaps = 9/60 (15%) Frame = -3 Query: 196 YFVGFQN-SEVMINRDNWGHSYCDVRGEILG------SSQD--EHQRKHLPKVFSSIKNE 44 Y VG+ N + ++++ WGHS+ +V E+L +QD E ++K+L ++ +S + + Sbjct: 142 YIVGYPNEARLLMDNFKWGHSFFEVNEELLDIYAQCHDAQDIQEKEKKYLEEMEASYQEQ 201 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 27.5 bits (58), Expect = 0.51 Identities = 14/57 (24%), Positives = 25/57 (43%) Frame = +2 Query: 119 TSNVAIRMPPVIPVNHYLGVLKTNKIEPRSYSIIPCTKYSSSIFSRFEHSNLFKVKL 289 T +++ +P + G+ +P I C KY S+ +S HS L ++L Sbjct: 208 TRKFLVKLAKALPDAKFFGIFDW---DPHGLCIYSCFKYGSNAYSHEPHSQLRNLQL 261 >SPBP8B7.09c |||karyopherin|Schizosaccharomyces pombe|chr 2|||Manual Length = 978 Score = 25.8 bits (54), Expect = 1.5 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 151 NWGHSYCDVRGEILGSSQDEHQRKHLPKVFSSIKNE 44 NW + ++G I SSQ E +L KV SI +E Sbjct: 123 NWNDFFASLQGVIAASSQSEFSNFYL-KVLLSIGDE 157 >SPBC15D4.03 |slm9||hira protein Slm9|Schizosaccharomyces pombe|chr 2|||Manual Length = 807 Score = 24.6 bits (51), Expect = 3.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 212 NMISVLFCWFSELRGND 162 N +S+L C FS L GND Sbjct: 476 NQLSLLKCTFSNLDGND 492 >SPBC16D10.04c |dna2||DNA replication endonuclease-helicase Dna2|Schizosaccharomyces pombe|chr 2|||Manual Length = 1398 Score = 24.2 bits (50), Expect = 4.7 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = -3 Query: 205 SRFYFVGFQNSEVMINRDNWGHSYCDVRGEILGS 104 S+ F+G ++ I++D + +RG ++ S Sbjct: 865 SKLSFIGSNHTRYRIDKDEFSSGIASIRGTLMSS 898 >SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1076 Score = 23.4 bits (48), Expect = 8.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 184 FQNSEVMINRDNWGHSYCDVRGEI 113 F +E +++ + SYC VRG I Sbjct: 267 FVETETILDSSKYCVSYCQVRGSI 290 >SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 23.4 bits (48), Expect = 8.3 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -1 Query: 297 WADNFTLNKLECSKRLKMLLEYFVHGIIEYDLGSILLVF 181 W T+N L ++ + L+Y +G++ D+ SIL V+ Sbjct: 488 WLFCVTVNSL--TQLVLKSLKYDTYGVVARDISSILAVY 524 >SPAC1687.04 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 23.4 bits (48), Expect = 8.3 Identities = 9/33 (27%), Positives = 19/33 (57%) Frame = -1 Query: 120 VKFLDRRKTNISESICQRCFHQSRTKVRGSKAI 22 +K+ +R + + +C +C+ TKV+ +AI Sbjct: 158 LKYSNRLQASNDTGVCVKCYGGMETKVQVCQAI 190 >SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 334 Score = 23.4 bits (48), Expect = 8.3 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = -1 Query: 108 DRRKTNISESICQRCFHQSRTKVRGSKA--IRY 16 + + N IC CFH + G KA +RY Sbjct: 190 ENSENNREALICSHCFHHNGLASYGEKASDVRY 222 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,258,797 Number of Sequences: 5004 Number of extensions: 22694 Number of successful extensions: 61 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 83936266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -