BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0260X.Seq (315 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 0.87 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 0.87 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 0.87 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 1.5 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 22 1.5 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 20 6.2 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 20 8.1 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 20 8.1 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 0.87 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +2 Query: 128 VAIRMPPVIPVNH-----YLGVLKTN 190 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 0.87 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +2 Query: 128 VAIRMPPVIPVNH-----YLGVLKTN 190 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 23.0 bits (47), Expect = 0.87 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +2 Query: 128 VAIRMPPVIPVNH-----YLGVLKTN 190 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 1.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 105 RRKTNISESICQRCFHQ 55 RR+ N++E++C F Q Sbjct: 966 RRRLNVNETVCSDYFSQ 982 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 22.2 bits (45), Expect = 1.5 Identities = 12/44 (27%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -1 Query: 129 TLEVKFLDRRKTNISESICQRCFHQSRTK--VRGSKAIRYRPSS 4 +L+ F D+ + + + +C+ C + RTK + K++++R SS Sbjct: 20 SLKRHFQDKHEQSDTLYVCEFCNRRYRTKNSLTTHKSLQHRGSS 63 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.2 bits (40), Expect = 6.2 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -3 Query: 142 HSYCDVRGEILGSSQDEHQRKHLP 71 H YC VR ++ R++LP Sbjct: 428 HCYCPVRFGRKADPNGDYIRRYLP 451 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 19.8 bits (39), Expect = 8.1 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = +2 Query: 248 FSRFEHSNLF 277 FS +EH N+F Sbjct: 278 FSHYEHQNVF 287 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 19.8 bits (39), Expect = 8.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 305 CRGGPTIL 282 C GGPTIL Sbjct: 370 CGGGPTIL 377 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,736 Number of Sequences: 438 Number of extensions: 1729 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 6719922 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -