BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0258.Seq (673 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35641-1|CAA84706.2| 863|Caenorhabditis elegans Hypothetical pr... 29 3.0 U53338-1|AAA96189.2| 152|Caenorhabditis elegans Hypothetical pr... 28 6.9 >Z35641-1|CAA84706.2| 863|Caenorhabditis elegans Hypothetical protein C38H2.1 protein. Length = 863 Score = 29.1 bits (62), Expect = 3.0 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = -1 Query: 466 NEHNARTSTRPGTGCIRFPSKPDTPRSSEPILIPKLRIQFADFPYLH 326 ++ TR G+ C S+PD P +L+ KL+I+ + H Sbjct: 43 HDEGCERMTRNGSVCAVEESEPDVPTQHREVLLTKLKIEIKNIMAEH 89 >U53338-1|AAA96189.2| 152|Caenorhabditis elegans Hypothetical protein C05E11.6 protein. Length = 152 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/60 (31%), Positives = 28/60 (46%) Frame = -2 Query: 363 SYGSNLPTSLTYIILSTRGSSPWRPAADMCTNRSDI*RTSLT*IFKVRREYNGHRRKCGA 184 +Y S L L I L+ +S W+ + R + + SL IF+VRR Y CG+ Sbjct: 8 AYLSLLVLILVLISLTDAHASSWKSILNS-DKRMETKQHSLESIFRVRRTYIDENENCGS 66 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,978,287 Number of Sequences: 27780 Number of extensions: 343617 Number of successful extensions: 1018 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 921 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1018 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1518563232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -