BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0257.Seq (715 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK094875-1|BAC04446.1| 149|Homo sapiens protein ( Homo sapiens ... 32 2.3 AB065580-1|BAC05810.1| 346|Homo sapiens seven transmembrane hel... 31 4.1 AK128797-1|BAC87611.1| 201|Homo sapiens protein ( Homo sapiens ... 30 9.5 >AK094875-1|BAC04446.1| 149|Homo sapiens protein ( Homo sapiens cDNA FLJ37556 fis, clone BRCAN2028545. ). Length = 149 Score = 31.9 bits (69), Expect = 2.3 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -3 Query: 512 CEFIMICKVHISFACLCTCVDLCYYKTTLFYSICVLTSV 396 C + +CK + AC+C CV +C + +CV V Sbjct: 102 CACVYVCKRVCTCACVCMCVQVCMCASVHMCIVCVSVRV 140 >AB065580-1|BAC05810.1| 346|Homo sapiens seven transmembrane helix receptor protein. Length = 346 Score = 31.1 bits (67), Expect = 4.1 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%) Frame = -3 Query: 524 IFLC-CEFIMICKVHIS---FACLCTCVDLCYYKTTLFYSICVLTSV 396 I +C C + +C V IS + CLC CV +C Y + Y +CV V Sbjct: 53 ICVCVCVCVSMC-VSISVCVYLCLCVCVSVCVYVSVCMY-LCVFLCV 97 >AK128797-1|BAC87611.1| 201|Homo sapiens protein ( Homo sapiens cDNA FLJ45585 fis, clone BRTHA3013882. ). Length = 201 Score = 29.9 bits (64), Expect = 9.5 Identities = 12/43 (27%), Positives = 20/43 (46%) Frame = -3 Query: 524 IFLCCEFIMICKVHISFACLCTCVDLCYYKTTLFYSICVLTSV 396 + +C + +C C+C CV LC ++ +CV SV Sbjct: 16 VCVCVLCVSVCVCVCLCVCVCVCVCLCLCVLSVSVCLCVCVSV 58 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 80,593,426 Number of Sequences: 237096 Number of extensions: 1488215 Number of successful extensions: 1762 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1738 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8343197486 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -