BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0253.Seq (465 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 3.2 AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase prot... 21 4.3 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 21 5.6 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 7.4 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 7.4 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 3.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 204 EAISLITFQQKSHRHLREMAFMMPVVKN 287 E I TFQ HR L E+ F V+N Sbjct: 79 EMIHRGTFQGDIHRDLTEVYFSFNSVRN 106 >AJ876407-1|CAI45288.1| 590|Tribolium castaneum phosphatase protein. Length = 590 Score = 21.4 bits (43), Expect = 4.3 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -3 Query: 238 LFCWNVIREIASDETKKNMLA*INLTINND 149 LFC NV+ E + +L L++ ND Sbjct: 504 LFCINVLAEACGSDITTRLLLPTVLSMAND 533 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = -3 Query: 289 SFFTTGIMNAISRRWR*LFCWNVI 218 SFF +++ + WR L+ W V+ Sbjct: 147 SFFLNFMLHCNNTTWRCLYRWIVL 170 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 20.6 bits (41), Expect = 7.4 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +3 Query: 156 FIVKFIYANIFFFVSSEAISLITFQQKSHRH 248 FI KF YA FF S + + + + HR+ Sbjct: 30 FIQKF-YAVAFFLALSIGVVVSIYSKSFHRN 59 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 20.6 bits (41), Expect = 7.4 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = -2 Query: 374 PHHASHVEP 348 P+HA+HV P Sbjct: 51 PYHANHVNP 59 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,063 Number of Sequences: 336 Number of extensions: 2177 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10721526 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -