BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0252.Seq (692 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22518| Best HMM Match : DUF847 (HMM E-Value=1.10001e-40) 30 2.0 SB_56276| Best HMM Match : Sod_Fe_C (HMM E-Value=6.6) 28 8.3 >SB_22518| Best HMM Match : DUF847 (HMM E-Value=1.10001e-40) Length = 598 Score = 29.9 bits (64), Expect = 2.0 Identities = 26/71 (36%), Positives = 39/71 (54%), Gaps = 5/71 (7%) Frame = +1 Query: 343 SFRIIFFFAKSSYSSSLTIFTYTSGANANHNLTKI-IPRSALTYK*YI----VFTNSNKL 507 +FRI F S+YSS LT +SGA +N T + + R A T+K Y+ T+++ L Sbjct: 24 NFRIDFSSGGSNYSSPLT----SSGATILNNWTHVALVREATTFKLYVNGVLKITHASAL 79 Query: 508 HAKSHSNYIFL 540 A + Y+FL Sbjct: 80 -AINDGRYLFL 89 >SB_56276| Best HMM Match : Sod_Fe_C (HMM E-Value=6.6) Length = 196 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 436 LTKIIPRSALTYK*YIVFTNSNKLHAKSHSNYIFLNNKINIRKPT 570 L++ +P SA+ + YI+F N HA+ + YI N KI ++ T Sbjct: 147 LSEKVPDSAVNIRDYILFRNDRPTHAEGVAAYI--NWKIPTKRLT 189 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,764,298 Number of Sequences: 59808 Number of extensions: 334722 Number of successful extensions: 622 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1805522550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -