BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0252.Seq (692 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g33210.1 68417.m04728 F-box family protein (FBL15) contains s... 28 6.8 At2g39800.2 68415.m04887 delta 1-pyrroline-5-carboxylate synthet... 28 6.8 At2g39800.1 68415.m04888 delta 1-pyrroline-5-carboxylate synthet... 28 6.8 At2g07722.1 68415.m00971 hypothetical protein 28 6.8 At5g15900.1 68418.m01860 expressed protein several hypothetical ... 27 8.9 At3g02440.1 68416.m00231 expressed protein 27 8.9 >At4g33210.1 68417.m04728 F-box family protein (FBL15) contains similarity to F-box protein FBL2 GI:6063090 from [Homo sapiens] Length = 942 Score = 27.9 bits (59), Expect = 6.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 208 CGVISGAHVQTPQATSFTHDFCHKLHE 128 CGV+S A + P TS FC +L + Sbjct: 679 CGVLSEASIMCPLLTSLDASFCSQLRD 705 >At2g39800.2 68415.m04887 delta 1-pyrroline-5-carboxylate synthetase A / P5CS A (P5CS1) identical to SP:P54887:P5C1_ARATH Length = 614 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 229 SEYVLLYCGVISGAHVQTPQATSFTHDFCHKLHETDVL 116 S V LY G + + P+A SF H++C K +V+ Sbjct: 467 SNGVTLYGGPRASKILNIPEARSFNHEYCAKACTVEVV 504 >At2g39800.1 68415.m04888 delta 1-pyrroline-5-carboxylate synthetase A / P5CS A (P5CS1) identical to SP:P54887:P5C1_ARATH Length = 717 Score = 27.9 bits (59), Expect = 6.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -2 Query: 229 SEYVLLYCGVISGAHVQTPQATSFTHDFCHKLHETDVL 116 S V LY G + + P+A SF H++C K +V+ Sbjct: 570 SNGVTLYGGPRASKILNIPEARSFNHEYCAKACTVEVV 607 >At2g07722.1 68415.m00971 hypothetical protein Length = 139 Score = 27.9 bits (59), Expect = 6.8 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 639 SEKFCFFFYIVLF*N 683 S K+CFFF++VLF N Sbjct: 74 SAKYCFFFFLVLFLN 88 >At5g15900.1 68418.m01860 expressed protein several hypothetical proteins - Arabidopsis thaliana Length = 426 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -2 Query: 208 CGVISGAHVQTPQATSFTHDFCHKLHE 128 C + SG V P+A +T+ C +HE Sbjct: 67 CDIFSGEWVPNPEAPYYTNTTCWAIHE 93 >At3g02440.1 68416.m00231 expressed protein Length = 373 Score = 27.5 bits (58), Expect = 8.9 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -2 Query: 208 CGVISGAHVQTPQATSFTHDFCHKLHE 128 C + SG + P+A +T+ C +HE Sbjct: 127 CDIFSGEWIPNPKAPYYTNTTCRAIHE 153 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,464,965 Number of Sequences: 28952 Number of extensions: 224545 Number of successful extensions: 347 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 347 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1477286152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -