BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0244.Seq (744 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 55 6e-10 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 3.0 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 9.2 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.2 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 9.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 9.2 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 9.2 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 9.2 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 9.2 AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly pro... 21 9.2 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.2 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 55.2 bits (127), Expect = 6e-10 Identities = 25/56 (44%), Positives = 35/56 (62%) Frame = +1 Query: 346 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPIAMSGKNLVA 513 +V VSG V PI+ FE A + V +K GYK+PTP+Q PI M+G++L+A Sbjct: 183 QVNVSGDNVPQPIESFEAAGLRNIVLDNIKKSGYKKPTPVQKHALPIIMNGRDLMA 238 Score = 37.1 bits (82), Expect = 2e-04 Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 4/77 (5%) Frame = +2 Query: 515 SQTGSGKTLAYILPAIVHINNQPP----IRRGDGPIALVLAPTRELAQQIQQVAADFGHT 682 +QTGSGKT A+ +P I + + P ++++PTREL QI Q F Sbjct: 240 AQTGSGKTAAFAVPIINTLLERSVDLVVTSTYCEPQVVIVSPTRELTIQIWQQIVKFSLN 299 Query: 683 SYVRNTCVFGGAPKREQ 733 S ++ +GG Q Sbjct: 300 SILKTVVAYGGTSVMHQ 316 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 23.0 bits (47), Expect = 3.0 Identities = 13/24 (54%), Positives = 13/24 (54%), Gaps = 2/24 (8%) Frame = -2 Query: 542 PTFCRNPFGYATKFFPDI--AIGQ 477 P CR G TK PDI AIGQ Sbjct: 22 PHTCRTKNGDYTKIMPDILTAIGQ 45 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 9.2 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 Query: 244 PIWASHVLPSREFFFP 197 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 465 SSSRLADSYVWKEFSGVAKRVPA 533 S + A +YVWK G ++ P+ Sbjct: 208 SYEQTAITYVWKNDEGTLRKSPS 230 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 465 SSSRLADSYVWKEFSGVAKRVPA 533 S + A +YVWK G ++ P+ Sbjct: 208 SYEQTAITYVWKNDEGTLRKSPS 230 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 465 SSSRLADSYVWKEFSGVAKRVPA 533 S + A +YVWK G ++ P+ Sbjct: 259 SYEQTAITYVWKNDEGTLRKSPS 281 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 9.2 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 465 SSSRLADSYVWKEFSGVAKRVPA 533 S + A +YVWK G ++ P+ Sbjct: 208 SYEQTAITYVWKNDEGTLRKSPS 230 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 9.2 Identities = 6/16 (37%), Positives = 8/16 (50%) Frame = -3 Query: 244 PIWASHVLPSREFFFP 197 P+W H+ R FP Sbjct: 634 PVWGRHIYDGRAMGFP 649 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 9.2 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = -2 Query: 743 SPGLALF*EHHQTHTCYEHKMCVQNLQQ 660 SP L HHQ HT + H Q Q Sbjct: 160 SPPLVESQMHHQMHTQHPHMQPQQGQHQ 187 >AF000632-1|AAC61894.1| 452|Apis mellifera major royal jelly protein MRJP2 protein. Length = 452 Score = 21.4 bits (43), Expect = 9.2 Identities = 7/18 (38%), Positives = 14/18 (77%) Frame = +1 Query: 304 KRSPYEVEEYRNKHEVTV 357 K P++V+++R+K VT+ Sbjct: 64 KNYPFDVDQWRDKTFVTI 81 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.2 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = -2 Query: 152 TETNYRRICCLLQIWNHRFHGYYSN 78 T N RR ++ W H F Y N Sbjct: 416 TVENNRRNPWFVEFWEHHFQCRYPN 440 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,303 Number of Sequences: 438 Number of extensions: 4478 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23266665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -