BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0240.Seq (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.0 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 23 1.8 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 5.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +1 Query: 310 WTSPSSRLTWCLTPVSTSHWSRTRQSSLPRRPTMNSFPS 426 W+S ++ W T + +R +S RPT ++P+ Sbjct: 1043 WSSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPT 1081 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 349 PVSTSHWSRTRQSSLPRRPT 408 P +T+HW +S RPT Sbjct: 1177 PSTTNHWQTKTTTSTTTRPT 1196 Score = 21.8 bits (44), Expect = 5.6 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +3 Query: 561 PSKPSVLSNSSTGVQPVSRSVSTTSHP 641 P+KPS S+T + STT+ P Sbjct: 1169 PTKPSYRPPSTTNHWQTKTTTSTTTRP 1195 Score = 21.8 bits (44), Expect = 5.6 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -2 Query: 208 YGGRCHRWLHC 176 Y G C R+LHC Sbjct: 1287 YPGDCTRYLHC 1297 Score = 21.0 bits (42), Expect = 9.8 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +3 Query: 624 STTSHPPWCPEATWPRFNVPSACCPTP 704 STT++P W P P S P P Sbjct: 1362 STTNYPEWQPTEWHPPIPPTSEKPPLP 1388 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 23.4 bits (48), Expect = 1.8 Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = +1 Query: 529 RTQGCERGHRYHQNQAYYPIRRLVSNRFQGRY--QLPATHRGARRRLGQGSTCRLHV 693 R ER N + +R+ + + Q P+T RGA ++L + T RL V Sbjct: 89 RRNARERNRVKQVNNGFATLRQHIPASVAAAFAPQGPSTGRGASKKLSKVETLRLAV 145 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 5.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 464 LVGGLEACVCDLG 426 L+GG +C CDLG Sbjct: 703 LMGGKWSCDCDLG 715 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,518 Number of Sequences: 336 Number of extensions: 4112 Number of successful extensions: 16 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -