BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0236.Seq (353 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0076 + 25637752-25639062,25639221-25639297,25640962-256410... 27 4.2 01_06_0460 + 29545030-29546377,29546463-29547085 26 9.8 >02_05_0076 + 25637752-25639062,25639221-25639297,25640962-25641095, 25641178-25641242,25641431-25641482,25641912-25641994, 25642128-25642221,25642332-25642861 Length = 781 Score = 27.1 bits (57), Expect = 4.2 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +1 Query: 172 LNGMNSSKSEKKPDQKFENNIYSNTLTNEN 261 L+G K ++ PD + ++NI NT N N Sbjct: 689 LSGSELDKDQEMPDAQHQSNIIRNTNPNHN 718 >01_06_0460 + 29545030-29546377,29546463-29547085 Length = 656 Score = 25.8 bits (54), Expect = 9.8 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +3 Query: 54 LDFQNETLNGSLNDNDFKIIDDHKNTTNTLKDEWFSKFFPE 176 L +N + GSL D DF + H L FS FPE Sbjct: 108 LSLKNNSFTGSLGDVDFSTLAPHLKLL-YLSGNGFSGRFPE 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,888,974 Number of Sequences: 37544 Number of extensions: 106735 Number of successful extensions: 243 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 243 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 530315984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -