BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0234.Seq (707 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 26 0.35 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 22 4.3 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 9.8 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 21 9.8 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 25.8 bits (54), Expect = 0.35 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +1 Query: 142 HRPKWSNFNSSVVTQSCSKANAARKPFASCSQMIIALI-ENSDEPCREK 285 H P+ S S +TQ +++P A + L+ NSD C+ K Sbjct: 24 HSPQQSIIVSGSITQPTKTVIQSKRPLAPAPERTSVLVTNNSDLRCKRK 72 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.2 bits (45), Expect = 4.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -3 Query: 87 WVCPCDGGSRSINHQDFYYLPFYS 16 W+C + S ++FYYLP S Sbjct: 49 WICALVNYNVSEISENFYYLPAMS 72 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.0 bits (42), Expect = 9.8 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 217 PFASCSQMIIALIENSDEPCREKQPS 294 PF+ C+ E ++P KQPS Sbjct: 62 PFSPCNNTANYKSEAQNQPSSYKQPS 87 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 21.0 bits (42), Expect = 9.8 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = -1 Query: 260 FSIRAIII*EHDANGFLAAFAFEQDCVTTEELKLLHF 150 FS + ++ D N + E++CV+ LK L F Sbjct: 47 FSFTSSMVQSLDGNSSDLENSSEENCVSMSNLKKLKF 83 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,642 Number of Sequences: 336 Number of extensions: 3603 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -