BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0221.Seq (616 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 27 0.36 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 27 0.64 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 1.5 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 27.5 bits (58), Expect = 0.36 Identities = 27/94 (28%), Positives = 42/94 (44%), Gaps = 18/94 (19%) Frame = +3 Query: 15 AETPRSAPSTVADSTLTMVVHIV---------VVGMTARP--MATECALGLKP------- 140 ++TPRS PS + + + + V +V V +T MA E ++ +P Sbjct: 27 SKTPRSPPSDLGECSASPTVEVVASTSVDSAVVEAVTGEENVMAAEDSVTSQPVESFSSS 86 Query: 141 KEPTPVLGTSVLKYRASTPGPVGALTKDNGRVEN 242 KEP V+G S L+ G + A TKD V + Sbjct: 87 KEPALVVGGSKLQEALKVAGELHAYTKDRNNVHH 120 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 26.6 bits (56), Expect = 0.64 Identities = 29/96 (30%), Positives = 40/96 (41%), Gaps = 8/96 (8%) Frame = +2 Query: 41 NGGRFDFDDGGTYCGSWDDGKAHGHGVCT-------GPKAQGAYAGSW-NFGFEVSGVYT 196 NG D D G GS D+G HG G + G K++G + N G S + Sbjct: 2033 NGNEND-DSGDGATGSGDNGSQHGGGSISGGGGTPGGGKSKGIIGSTQANIGIVDSNISP 2091 Query: 197 WPSGSTYEGQWQSGKRHGLVSKTATGGFIAVNGHKV 304 S + G Q + LV + GF+ NGH+V Sbjct: 2092 KESPDSI-GDPQGRQTAVLVE---SDGFVTKNGHRV 2123 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.4 bits (53), Expect = 1.5 Identities = 10/33 (30%), Positives = 14/33 (42%) Frame = +2 Query: 122 CTGPKAQGAYAGSWNFGFEVSGVYTWPSGSTYE 220 C QG Y ++F FE V + TY+ Sbjct: 1537 CQNATRQGGYFDQYSFNFEYKDVSNYAKNLTYQ 1569 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 752,067 Number of Sequences: 2352 Number of extensions: 18649 Number of successful extensions: 71 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -