BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0212.Seq (748 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory recept... 26 0.37 DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 25 0.85 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 22 4.5 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 6.0 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 7.9 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 7.9 >AM292361-1|CAL23173.2| 373|Tribolium castaneum gustatory receptor candidate 40 protein. Length = 373 Score = 25.8 bits (54), Expect = 0.37 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = -1 Query: 343 LFEFVEINSGVIAHYADSTDLVKSIKFGS 257 L E+ +I ++ HY +TDL K I++ + Sbjct: 120 LNEWTKIEINLLKHYQSTTDLHKKIRYSA 148 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 24.6 bits (51), Expect = 0.85 Identities = 12/53 (22%), Positives = 22/53 (41%) Frame = +1 Query: 475 DQVEERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSNVAHTLA 633 D V R+ S P + CTP + ++ + +PK ++ + H A Sbjct: 59 DPVGRRLKSLAPLVLRGSCPQCTPQEMKQIQKVLAFVQKNYPKEWNKILHQYA 111 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 69 TLGCTSVICSDKTGTLTTNQMSVS 140 T C+S SDK T TT+ ++V+ Sbjct: 44 TKDCSSPTPSDKLNTSTTSSVNVN 67 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 6.0 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 626 RSRRHQQGSSDHDPEEPHLGPDPPVRYWSRHAALLGLATAD 748 R R H EE P P VR AA G A AD Sbjct: 257 RRRHHLVHHKCGGEEEAERAPAPAVRAAGDAAAARGAARAD 297 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.4 bits (43), Expect = 7.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 650 SSDHDPEEPHLGPDPP 697 +S HD P GP PP Sbjct: 266 ASQHDLGSPSSGPAPP 281 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = -3 Query: 527 IDFLSRGTRE*ILSSTWSQFLDARQ 453 +++ SRG + L + W +F + +Q Sbjct: 532 VEYCSRGDLQTYLRTAWDKFTNMQQ 556 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,604 Number of Sequences: 336 Number of extensions: 3285 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -