BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0212.Seq (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_52615| Best HMM Match : No HMM Matches (HMM E-Value=.) 77 1e-14 SB_227| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) 62 4e-10 SB_14419| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) 62 5e-10 SB_47271| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48903| Best HMM Match : E1-E2_ATPase (HMM E-Value=3) 36 0.035 SB_53041| Best HMM Match : E1-E2_ATPase (HMM E-Value=5.7e-20) 33 0.33 SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) 32 0.57 SB_14128| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_31565| Best HMM Match : efhand (HMM E-Value=3.4e-06) 30 1.7 SB_23869| Best HMM Match : rve (HMM E-Value=2.2e-16) 30 1.7 SB_21964| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 29 4.0 SB_59443| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) 28 7.0 SB_52167| Best HMM Match : Extensin_2 (HMM E-Value=3.6) 28 7.0 SB_45142| Best HMM Match : Herpes_IE68 (HMM E-Value=3.8) 28 7.0 SB_40649| Best HMM Match : AT_hook (HMM E-Value=3.7) 28 7.0 SB_35108| Best HMM Match : AT_hook (HMM E-Value=0.15) 28 7.0 SB_34667| Best HMM Match : AT_hook (HMM E-Value=3.7) 28 7.0 SB_32994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_27062| Best HMM Match : DUF497 (HMM E-Value=4.9) 28 7.0 SB_23956| Best HMM Match : AT_hook (HMM E-Value=3.7) 28 7.0 SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11) 28 7.0 SB_7962| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_59576| Best HMM Match : rve (HMM E-Value=3.7e-14) 28 7.0 SB_42307| Best HMM Match : AT_hook (HMM E-Value=3.7) 28 7.0 SB_33158| Best HMM Match : rve (HMM E-Value=7.5e-05) 28 7.0 SB_15059| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1311 Score = 116 bits (279), Expect = 2e-26 Identities = 53/77 (68%), Positives = 63/77 (81%) Frame = +3 Query: 24 MAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFEKIEGGDSSFLEFEIT 203 MAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSV + F+ + I G + F EFE+ Sbjct: 341 MAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVHKFFVMKDISRGRAEFHEFEVE 400 Query: 204 GSTYEPIGDVYLKGQKV 254 G+TY+P+GD+ G+ V Sbjct: 401 GTTYDPVGDITKDGRNV 417 Score = 90.6 bits (215), Expect = 1e-18 Identities = 39/83 (46%), Positives = 57/83 (68%) Frame = +2 Query: 260 AEFDALHEIGTICVMCNDSAIDFNEFKQAFEKVGEATETALIVLAEKMNPFNVPKTGLDR 439 ++++ L E TIC +CNDS++D+N + ++EKVGE+TETALIVL EK+N NV G + Sbjct: 420 SDYEVLPEFATICSLCNDSSVDYNNVRDSYEKVGESTETALIVLVEKLNVLNVDLEGKTK 479 Query: 440 RSSAIVVRQEIETKWKKEFTLEF 508 A + + I+ + KEFTLEF Sbjct: 480 AQLATICNESIKNHFNKEFTLEF 502 Score = 69.7 bits (163), Expect = 2e-12 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +3 Query: 588 QGAPEGVLERCTHARVGTSKVPLTTTLKNRILDLTRQYGTGRDTLRCLA 734 +GAPEG+L+RC RVG K P+T +K +ILDL + YGTG DTLRCLA Sbjct: 533 KGAPEGILDRCDFVRVGNKKHPMTPKMKAQILDLIKAYGTGADTLRCLA 581 Score = 34.7 bits (76), Expect = 0.081 Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 3/34 (8%) Frame = +1 Query: 511 RDRKSMSTYCTPLKP---SRLGNGPKLFVREHPK 603 RDRKSMS YC P K S L PK+FV+ P+ Sbjct: 504 RDRKSMSVYCVPQKDGPNSFLDGKPKMFVKGAPE 537 >SB_52615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1154 Score = 77.4 bits (182), Expect = 1e-14 Identities = 41/72 (56%), Positives = 51/72 (70%) Frame = +3 Query: 24 MAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFEKIEGGDSSFLEFEIT 203 MAK+NAIV+ LP VETLGC+SVICSDKTGTLT N+M+VS++F D + E T Sbjct: 394 MAKRNAIVKKLPIVETLGCSSVICSDKTGTLTKNEMTVSQIFT------ADGFYA--EAT 445 Query: 204 GSTYEPIGDVYL 239 G Y P+G+V L Sbjct: 446 GVGYSPLGEVIL 457 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = +3 Query: 540 HTPQTLAPRQRTQTICQGAPEGVLERCTHARVGTSKVPLTTTLKNRILD 686 H +A R +GAPE V+ +CT S VP+T RI D Sbjct: 508 HRSSAMAEIARDIYYVKGAPENVMRQCTSYYKNGSAVPMTAKDVERIGD 556 >SB_227| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) Length = 1003 Score = 62.5 bits (145), Expect = 4e-10 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +3 Query: 24 MAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFEKIEGGDSS 182 MA KN +V++L +VETLG TS ICSDKTGTLT N+M+V+ ++ I D+S Sbjct: 350 MASKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWYDNNIVEADTS 402 >SB_14419| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) Length = 543 Score = 62.1 bits (144), Expect = 5e-10 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +3 Query: 24 MAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFEKIEGGDSS 182 MA KN +V++L +VETLG TS ICSDKTGTLT N+M+V+ M+ K D++ Sbjct: 318 MAAKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNKTFEADTT 370 >SB_47271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 811 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/42 (52%), Positives = 31/42 (73%) Frame = +3 Query: 24 MAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMF 149 M N +VR L + ET+G + ICSDKTGTLTTN+M+V +++ Sbjct: 418 MLDDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQLY 459 >SB_48903| Best HMM Match : E1-E2_ATPase (HMM E-Value=3) Length = 351 Score = 35.9 bits (79), Expect = 0.035 Identities = 21/58 (36%), Positives = 30/58 (51%) Frame = +3 Query: 42 IVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFEKIEGGDSSFLEFEITGSTY 215 +VRS E LG + +DKTGTLT N+M R+ + + G S E +T + Y Sbjct: 251 VVRSSTIPEELGRIGYLLTDKTGTLTQNEMVFKRLHL-GTVSFGTDSMEEVFVTHTCY 307 >SB_53041| Best HMM Match : E1-E2_ATPase (HMM E-Value=5.7e-20) Length = 704 Score = 32.7 bits (71), Expect = 0.33 Identities = 15/47 (31%), Positives = 30/47 (63%) Frame = +3 Query: 24 MAKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRMFIFEKI 164 M ++ VR+ +ET+G + +C +KTG LT +VS++ ++E++ Sbjct: 354 MCAQDIFVRNADVLETMGSVTTLCCNKTGVLT----AVSKIPLYEEV 396 >SB_20525| Best HMM Match : E1-E2_ATPase (HMM E-Value=0) Length = 1145 Score = 31.9 bits (69), Expect = 0.57 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +3 Query: 27 AKKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQMSVSRM 146 A++ ++++ +ETL V+ DKTGTLT + V+ M Sbjct: 753 ARRGSLIKKGEHLETLAKLEVLAFDKTGTLTEGKFQVTDM 792 >SB_14128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1138 Score = 31.1 bits (67), Expect = 0.99 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +3 Query: 42 IVRSLPSVETLGCTSVICSDKTGTLTTNQM 131 I R+L E LG + SDKTGTLT N+M Sbjct: 339 ICRALNINEDLGQIKYVFSDKTGTLTENKM 368 >SB_47174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1198 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -1 Query: 454 NSRGSAI*ASLRNIEGIHFFSKNNQSSLSSFADLFERL 341 NSRG +L I+ + FSK+ + L A++FERL Sbjct: 365 NSRGLEYKCALIYIDDLIIFSKSEEEHLEHLAEIFERL 402 >SB_31565| Best HMM Match : efhand (HMM E-Value=3.4e-06) Length = 129 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 311 DSAIDFNEFKQAFEKVGEATETALIVLAEKMNPFNVPKTGL 433 D A+D+ EF + F +GE ET + + + F+ KTGL Sbjct: 14 DGALDYGEFVRGF--IGEMNETRKAYVRKVFHKFDPSKTGL 52 >SB_23869| Best HMM Match : rve (HMM E-Value=2.2e-16) Length = 1456 Score = 30.3 bits (65), Expect = 1.7 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +2 Query: 359 GEATETALIVLAEKMNPFNVPKTGLDRRSSAIVVRQEIE 475 G+ T T+L V AE+ P N R++AI +RQ++E Sbjct: 426 GDPTLTSLAVSAERAIPLNPRDAFFGGRTNAITLRQDVE 464 >SB_21964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +2 Query: 437 RRSSAIVVRQEIETKWKKEFTLEFLVTGNLCRHTAHPSN 553 R++ +++ EI T+ ++ L F TG+LC T H +N Sbjct: 185 RQAPDVILMGEIRTQELMKYGLAFAETGHLCMATLHANN 223 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +2 Query: 227 RRLSERTES*AAEFDALHEIGTICVMCNDSAIDFNEFKQAFEKV 358 R L++ +E+ E D++ ++ M D IDFNEF +AF V Sbjct: 342 RLLNQHSETEIPE-DSIQDLARSIDMDKDGYIDFNEFLEAFRLV 384 >SB_59443| Best HMM Match : RVT_1 (HMM E-Value=3.8e-07) Length = 942 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 738 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 779 >SB_52167| Best HMM Match : Extensin_2 (HMM E-Value=3.6) Length = 287 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 73 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 114 >SB_45142| Best HMM Match : Herpes_IE68 (HMM E-Value=3.8) Length = 292 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 124 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 165 >SB_40649| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 240 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 26 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 67 >SB_35108| Best HMM Match : AT_hook (HMM E-Value=0.15) Length = 1600 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 757 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 798 >SB_34667| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 240 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 26 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 67 >SB_32994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 453 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 494 >SB_27062| Best HMM Match : DUF497 (HMM E-Value=4.9) Length = 325 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 624 HARVGTSKVPLTTTLKNRILDLTRQYGTGRDTLRCLAW 737 H G S+ L+N+ LD Q+ G++T+R W Sbjct: 63 HLLFGVSRPATLKILRNQQLDTRGQFTVGKETIRADCW 100 >SB_23956| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 240 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 26 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 67 >SB_17624| Best HMM Match : rve (HMM E-Value=2.2e-11) Length = 1213 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 999 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 1040 >SB_7962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1269 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 1055 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 1096 >SB_59576| Best HMM Match : rve (HMM E-Value=3.7e-14) Length = 707 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 659 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 700 >SB_42307| Best HMM Match : AT_hook (HMM E-Value=3.7) Length = 269 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 55 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 96 >SB_33158| Best HMM Match : rve (HMM E-Value=7.5e-05) Length = 848 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = +1 Query: 484 EERIHSRVPRDRKSMSTYCTPLKPSRLGNGPKLFVREHPKVYSN 615 E+ + +R+ R +S++++ PL+P +LG ++F++ + N Sbjct: 634 EDALRTRISRTTESLTSHSKPLRPLKLGE--RVFIQNQQGPHPN 675 >SB_15059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 28.3 bits (60), Expect = 7.0 Identities = 16/53 (30%), Positives = 24/53 (45%) Frame = -3 Query: 668 QGRGQRNLAGADASVCATFEYTFGCSLTNSLGPLPRREGLRGVQYVDIDFLSR 510 +G R L GA +++C T +FG +T + R E + D FL R Sbjct: 450 RGEQVRKLLGAGSTMCGTDSVSFGSPVTTNYAVENRYENYSELGLCDSIFLDR 502 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,926,287 Number of Sequences: 59808 Number of extensions: 487287 Number of successful extensions: 1819 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1818 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -