BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0208.Seq (726 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) 30 2.2 SB_58196| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-10) 29 2.9 SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_23091| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_10333| Best HMM Match : ATP1G1_PLM_MAT8 (HMM E-Value=0.73) 29 5.1 SB_57101| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 28 6.7 SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) 28 6.7 SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) 28 8.9 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_41405| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 2639 Score = 29.9 bits (64), Expect = 2.2 Identities = 16/38 (42%), Positives = 19/38 (50%) Frame = -2 Query: 200 VVHGVTGRLHAERSGVSHAGRPGSSPTGDSSAPGHRPA 87 V++GVTG L S + PT D S P HRPA Sbjct: 53 VINGVTGALAKTIPSSSPSKIAAYEPTPDPSRPPHRPA 90 >SB_58196| Best HMM Match : 7tm_1 (HMM E-Value=6.7e-10) Length = 334 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = -3 Query: 472 RADSRHICKHSASRVSRPPASNRRCELSEAAYNVASRQ 359 RA R +CK++ +R +P A N C++S A + +RQ Sbjct: 295 RAFKRLVCKYARNRSVQPIALNVVCDVSLPAITLGTRQ 332 >SB_40529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1437 Score = 28.7 bits (61), Expect = 5.1 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -2 Query: 200 VVHGVTGRLHAERSGVSHAGRPGSSPTGDSSAPGHRPA 87 V++GVTG L + + PT D S P HRPA Sbjct: 354 VINGVTGALAKTIPSSNPSKIAAYEPTPDPSRPPHRPA 391 >SB_23091| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = -2 Query: 200 VVHGVTGRLHAERSGVSHAGRPGSSPTGDSSAPGHRP 90 V++GVTG L + + PT D+S P HRP Sbjct: 148 VINGVTGALAKTIPSSNPSKIAAYEPTPDTSRPSHRP 184 >SB_10333| Best HMM Match : ATP1G1_PLM_MAT8 (HMM E-Value=0.73) Length = 150 Score = 28.7 bits (61), Expect = 5.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +2 Query: 35 VPQTAPTQEMEQPEGQKVQDGAPVQMS 115 VP T +E P+G + DG PVQ S Sbjct: 63 VPSTPDKGTVESPKGNRTYDGVPVQES 89 >SB_57101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 855 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = -2 Query: 200 VVHGVTGRLHAERSGVSHAGRPGSSPTGDSSAPGHRP 90 V++GVTG L S + PT D S P HRP Sbjct: 134 VINGVTGALAKTIPSSSPSKIAAYEPTPDPSRPPHRP 170 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 28.3 bits (60), Expect = 6.7 Identities = 15/42 (35%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = -2 Query: 191 GVTGRLHAERSGVSHA---GRPGSSPTGDSSAPGHRPAPSGP 75 G T +++ G S + G G GD S+P HR +PS P Sbjct: 935 GTTSGVYSMGGGPSDSDDNGDRGDDGDGDGSSPSHRSSPSTP 976 >SB_20844| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 2675 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 147 CRSAGVKPHGRLICTGAPSCTFWPSG 70 C G KP G +CT C W +G Sbjct: 323 CTGVGAKPSGTRLCTLTRYCPVWATG 348 >SB_3674| Best HMM Match : Retrotrans_gag (HMM E-Value=1.7e-06) Length = 882 Score = 27.9 bits (59), Expect = 8.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -2 Query: 200 VVHGVTGRLHAERSGVSHAGRPGSSPTGDSSAPGHRP 90 V++GVTG L + + PT D S P HRP Sbjct: 252 VINGVTGALAKTIPSSNPSKIAAYEPTPDPSRPSHRP 288 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 27.9 bits (59), Expect = 8.9 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 131 SSPTGDSSAPGHRPAPSGPQ 72 S PT PGHRP P G Q Sbjct: 1366 SRPTAPLPTPGHRPEPHGAQ 1385 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,973,936 Number of Sequences: 59808 Number of extensions: 424459 Number of successful extensions: 1388 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1178 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1385 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1937927537 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -